Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   2145
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9VBW3    (Created: 2003-01-27 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   CAD96_DROME
Protein Name   Tyrosine kinase receptor Cad96Ca
Gene   Cad96Ca
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   773
Protein Mass [Da]   86220
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   48
chain   Tyrosine kinase receptor Cad96Ca      49   773
transmembrane region      potential   316   336
topological domain   Extracellular   potential   49   315
topological domain   Cytoplasmic   potential   337   773
domain   Cadherin      58   172
domain   Protein kinase      470   749
glycosylation site   N-linked (GlcNAc...)   potential   126   126
glycosylation site   N-linked (GlcNAc...)   potential   164   164
glycosylation site   N-linked (GlcNAc...)   potential   180   180
glycosylation site   N-linked (GlcNAc...)   potential   278   278
glycosylation site   N-linked (GlcNAc...)   potential   279   279
glycosylation site   N-linked (GlcNAc...)   potential   300   300
glycosylation site   N-linked (GlcNAc...)   potential   301   301
active site   Proton acceptor   by similarity   610   610
binding site   ATP   by similarity   504   504
compositionally biased region   Pro-rich      202   236
nucleotide phosphate-binding region   ATP   by similarity   476   484
SP Length   48
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MVYHHHNHESRIIHCRKQLTSWRRRSLLLTIIVVTATVVSLISQEAEA
Sequence MVYHHHNHESRIIHCRKQLTSWRRRSLLLTIIVVTATVVSLISQEAEAHN
QNAPPIL
YVRERNWRISETEKVGQIIDRVRAEDPDGDDLIFGIEPRFSLP
GGENDASPPEKIPFQIDRETGVVTL
NESLAGRAGQNFLIYITVTDGSYTA
KNEVFINILGERE
NSSGYRPQTSISNVVHNISQFLPRFDQLPGVQSIRNG
L
PNSRPGGWYPPVPQNNIFGPPPFGNNYPPPPPNIPGVRGEQSGEEEQPD
EEVTPTTPVRISSTTPKSRTKLTPITA
NNSTRVESAIPAETTTPSGGHHN
NSSSPITIFSLKSGTIPIVVTVGGFFVAIAVLLAYLCRRRLCAISRTLKK
TKEKEELAKKSNQSQLSSTLTDDSRNSMVMQQWQGPVAFANRYVPWERDQ
QMGIATSQLSTGVTNGGVSSPGVPSPGTGEPGSNLGPGCLTGGAGSSGAP
ENAFAGEANCDRWEFPRYR
LKFFNILGEGAFGQVWRCEATNINGNEGITT
VAV
KTLKESATEVDRKDLLSELEVMKSLEPHINVVHLLGCCTDKDPTFVI
LEYVNRGKLQTYLRSSRAERHYGNTHGKSNVLTSCDLTSFMYQVAKGMDY
LTSRGIIHR
DLAARNILITDDHTCKVADFGFARDVITSKIYERKSEGKLP
IRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISAADVMRKV
RDGYRLEKPEHCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLLHTEM
D
YIELERFPDHNYYNIVSLSGEKL
Original MVYHHHNHESRIIHCRKQLTSWRRRSLLLTIIVVTATVVSLISQEAEAHN
QNAPPILYVRERNWRISETEKVGQIIDRVRAEDPDGDDLIFGIEPRFSLP
GGENDASPPEKIPFQIDRETGVVTLNESLAGRAGQNFLIYITVTDGSYTA
KNEVFINILGERENSSGYRPQTSISNVVHNISQFLPRFDQLPGVQSIRNG
LPNSRPGGWYPPVPQNNIFGPPPFGNNYPPPPPNIPGVRGEQSGEEEQPD
EEVTPTTPVRISSTTPKSRTKLTPITANNSTRVESAIPAETTTPSGGHHN
NSSSPITIFSLKSGTIPIVVTVGGFFVAIAVLLAYLCRRRLCAISRTLKK
TKEKEELAKKSNQSQLSSTLTDDSRNSMVMQQWQGPVAFANRYVPWERDQ
QMGIATSQLSTGVTNGGVSSPGVPSPGTGEPGSNLGPGCLTGGAGSSGAP
ENAFAGEANCDRWEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGITT
VAVKTLKESATEVDRKDLLSELEVMKSLEPHINVVHLLGCCTDKDPTFVI
LEYVNRGKLQTYLRSSRAERHYGNTHGKSNVLTSCDLTSFMYQVAKGMDY
LTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITSKIYERKSEGKLP
IRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISAADVMRKV
RDGYRLEKPEHCRRELYNIMYYCWSHDPQERPLFAEIIQMLDKLLHTEMD
YIELERFPDHNYYNIVSLSGEKL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11