Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   2182
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P07184    (Created: 1988-04-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   CH18_DROME
Protein Name   Chorion protein S18
Gene   Cp18
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   172
Protein Mass [Da]   17231
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   17
chain   Chorion protein S18      18   172
compositionally biased region   Gly-rich      21   94
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MMKFMCICLCAISAVSA
Sequence MMKFMCICLCAISAVSANSYGRSRGGYGGAPVGGYAYQVQPALTVKAIVP
SYGGGYGGNHGGYGGAYESVPVPVSSAYSGANVGSQYSGSGYGG
APPVDA
QAIALAKLALAAPSAGAPLVWKEAPRYAQPVYPPTSYVNQEYGHSEKVKG
GSAAAAASSVAAGKKGYKRPSY
Original MMKFMCICLCAISAVSANSYGRSRGGYGGAPVGGYAYQVQPALTVKAIVP
SYGGGYGGNHGGYGGAYESVPVPVSSAYSGANVGSQYSGSGYGGAPPVDA
QAIALAKLALAAPSAGAPLVWKEAPRYAQPVYPPTSYVNQEYGHSEKVKG
GSAAAAASSVAAGKKGYKRPSY
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11