Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   2427
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8SXT3    (Created: 2004-12-07 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   HFW2_DROME
Protein Name   Protein singed wings 2
Gene   swi2
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   499
Protein Mass [Da]   58032
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   29
chain   Protein singed wings 2      30   499
repeat   LRR 1      129   152
repeat   LRR 2      153   175
repeat   LRR 3      177   199
repeat   LRR 4      355   378
SP Length   29
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MPSGVFQKRPKAAETISLFCMILIRLSRA
Sequence MPSGVFQKRPKAAETISLFCMILIRLSRAADDSHETSTLLATITTITTEI
IPMPDSGRSCFGWSSAPEAAGGNCSRSNRNGTLKCYGGMNNLAALNQSGK
LSRVQPALEMLLCGWPKDGLNHFRDLQK
LPRLRSLTIEYSGFTEFKFDFP
EM
LELHTINISWTNLSYISSRTFKRVHPLKVLDLRWNQLIQLDGPLLLPR
NFEQLYLAGNPWNCTRNFKWLLLQPEKGRLVVDRDELICTDRKYKERQML
MVMHYKLELKRQCQSHEDLRNCTCLMHHILPKTHIPLYTVNCSHLQFHRL
PDFLPDNTTTLVINDNMISDINPLRDNPHYRHVVDMQLENNQISNVDNLE
DTYW
LQNFRLLNLRGNNLRKLHVYALDNALDDNENANLLLLSRNPWHCTC
KFGSRMRELLTKYKDIVRDAWNVSCTYRLDDDQLLAKVLTLSRQEMCNLS
VEGGTQIHPIDWLNGVLASLIFLILGKLAYDYYYYKYYGRVPWIVMKMP
Original MPSGVFQKRPKAAETISLFCMILIRLSRAADDSHETSTLLATITTITTEI
IPMPDSGRSCFGWSSAPEAAGGNCSRSNRNGTLKCYGGMNNLAALNQSGK
LSRVQPALEMLLCGWPKDGLNHFRDLQKLPRLRSLTIEYSGFTEFKFDFP
EMLELHTINISWTNLSYISSRTFKRVHPLKVLDLRWNQLIQLDGPLLLPR
NFEQLYLAGNPWNCTRNFKWLLLQPEKGRLVVDRDELICTDRKYKERQML
MVMHYKLELKRQCQSHEDLRNCTCLMHHILPKTHIPLYTVNCSHLQFHRL
PDFLPDNTTTLVINDNMISDINPLRDNPHYRHVVDMQLENNQISNVDNLE
DTYWLQNFRLLNLRGNNLRKLHVYALDNALDDNENANLLLLSRNPWHCTC
KFGSRMRELLTKYKDIVRDAWNVSCTYRLDDDQLLAKVLTLSRQEMCNLS
VEGGTQIHPIDWLNGVLASLIFLILGKLAYDYYYYKYYGRVPWIVMKMP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11