Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   280
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P25725    (Created: 1992-05-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   EST5C_DROPS
Protein Name   Esterase-5C
Gene   Est-5C
Organism Scientific   Drosophila pseudoobscura pseudoobscura
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   545
Protein Mass [Da]   61021
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Esterase-5C      20   545
disulfide bond      by similarity   84   103
disulfide bond      by similarity   259   271
disulfide bond      potential   515   536
glycosylation site   N-linked (GlcNAc...)   potential   113   113
glycosylation site   N-linked (GlcNAc...)   potential   421   421
glycosylation site   N-linked (GlcNAc...)   potential   507   507
sequence variant   (in strain: GB4E, JR50E, GB115E, GB139E, GB336E, JR341E)      0   0
sequence variant   (in strain: GB4E, JR50E, GB115E, GB139E, GB336E, JR341E)      0   0
sequence variant   (in strain: JR50E)      0   0
sequence variant   (in strain: GB115E)      0   0
sequence variant   (in strain: GB336E)      0   0
sequence variant   (in strain: JR341E)      0   0
sequence variant   (in strain: JR50E, GB8E, GB115E)      0   0
sequence variant   (in strain: JR50E, GB139E)      0   0
sequence variant   (in strain: GB8E, GB336E)      0   0
sequence variant   (in strain: GB4E)      0   0
sequence variant   (in strain: GB8E)      0   0
sequence variant   (in strain: JR50E, JR341E)      0   0
active site   Acyl-ester intermediate   by similarity   207   207
active site   Charge relay system   by similarity   467   467
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLAARLIILLSFYWLSASA
Sequence MLAARLIILLSFYWLSASAIDPADPLFVDLPHGKIRGRDNGFYYSYESLP
YAEPPVGELRFEAPQPYKQQWTDTFDATQPPVT
CMQWNQFIFGDNKLVGV
EDC
LTVSIYKPKNTSQSSFPVVAHMHGGAFMFGEARQNGHENMMREGKLI
LVKISYRLGPLGFASTGDADLSGNFGLKDQRLALLWIKQNIASFGGEPEN
IIVVGH
SAGGASVHLQMLREDFAQVAKAGISFGGNAMDPWVIHQSARGRT
FELGRIVG
CGQASDSMELKNCLKSKPAGEIVSAVHSFLVFAYVPFAPFGP
VVESPDAPEAFISQHPVDIIKSGKFAQVPWAVTYNTEDGGYNAAVLLEKQ
ASSGRELIFDLNDHWFDWAPYLLFYRDSMTTIKDMDDYSRKLRQEYLGDR
RFSVESYWDLQRLFTDILYK
NATELALDLYRKHGKSPVYAFVYDNPANTG
IGQFFAKRTDVHFGTV
HGDEYFLIFENLARGPEMRSDEEIISRNFLNMIN
DFVVSG
NGTMTFGNCVLQDNVGSNKFQLLSITKNGCENLQLESFP
Original MLAARLIILLSFYWLSASAIDPADPLFVDLPHGKIRGRDNGFYYSYESLP
YAEPPVGELRFEAPQPYKQQWTDTFDATQPPVTCMQWNQFIFGDNKLVGV
EDCLTVSIYKPKNTSQSSFPVVAHMHGGAFMFGEARQNGHENMMREGKLI
LVKISYRLGPLGFASTGDADLSGNFGLKDQRLALLWIKQNIASFGGEPEN
IIVVGHSAGGASVHLQMLREDFAQVAKAGISFGGNAMDPWVIHQSARGRT
FELGRIVGCGQASDSMELKNCLKSKPAGEIVSAVHSFLVFAYVPFAPFGP
VVESPDAPEAFISQHPVDIIKSGKFAQVPWAVTYNTEDGGYNAAVLLEKQ
ASSGRELIFDLNDHWFDWAPYLLFYRDSMTTIKDMDDYSRKLRQEYLGDR
RFSVESYWDLQRLFTDILYKNATELALDLYRKHGKSPVYAFVYDNPANTG
IGQFFAKRTDVHFGTVHGDEYFLIFENLARGPEMRSDEEIISRNFLNMIN
DFVVSGNGTMTFGNCVLQDNVGSNKFQLLSITKNGCENLQLESFP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11