Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   358
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P33438    (Created: 1994-02-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   GLT_DROME
Protein Name   Glutactin
Gene   Glt
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   1026
Protein Mass [Da]   118749
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   17
chain   Glutactin      18   1026
disulfide bond      by similarity   123   145
disulfide bond      by similarity   298   316
modified residue   Sulfotyrosine   potential   26   26
modified residue   Sulfotyrosine   potential   29   29
modified residue   Sulfotyrosine   potential   182   182
modified residue   Sulfotyrosine   potential   559   559
modified residue   Sulfotyrosine   potential   645   645
modified residue   Sulfotyrosine   potential   727   727
modified residue   Sulfotyrosine   potential   836   836
modified residue   Sulfotyrosine   potential   862   862
modified residue   Sulfotyrosine   potential   865   865
modified residue   Sulfotyrosine   potential   868   868
modified residue   Sulfotyrosine   potential   922   922
modified residue   Sulfotyrosine   potential   928   928
modified residue   Sulfotyrosine   potential   981   981
modified residue   Sulfotyrosine   potential   984   984
modified residue   Sulfotyrosine   potential   1006   1006
glycosylation site   N-linked (GlcNAc...)   potential   115   115
glycosylation site   N-linked (GlcNAc...)   potential   368   368
glycosylation site   N-linked (GlcNAc...)   potential   402   402
glycosylation site   N-linked (GlcNAc...)   potential   810   810
compositionally biased region   Thr-rich      595   615
compositionally biased region   Gln/Glu-rich      616   1026
compositionally biased region   Arg-rich      647   749
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKPLLLVLALCGAQVHA
Sequence MKPLLLVLALCGAQVHAHSVGLRPDYNDYSDEDTRRDWLPEPLKPVPWQS
ETRYAQPQEAVVQAPEVGQILGISGHKTIANRPVNAFLGIRYGTVGGGLA
RFQAAQPIGYQGRV
NATVQSPNCAQFPELDRLRLSESRGENVDDCLTLDI
YAPEGANQLPVLVFVHGEMLFDGGSEEAQPD
YVLEKDVLLVSINYRLAPF
GFLSALTDELPGNVALSDLQLALEWLQRNVVHFGGNAGQVTLVGQAGGAT
LAHALSLSGRAGNLFQQLILQSGTALNPYLIDNQPLDTLSTFARLAR
CPP
PSINPSAQGLKPLYDC
LARLPTSQLVAAFEQLLLQNEHLGLTQLGGFKLV
VGDPLGFLPSHPASLAT
NSSLALPMIIGATKDASAFIVSRIYDQLARLQS
R
NVSDYIDVVLRHTAPPSEHRLWKQWALREIFTPIQEQTASLQTVAPGLL
ELSNYILYRAPVINSISQSYRSVPAYLYTFDYRGEHHRFGHLSNPLPFGV
DASLSDDSVYLFPYPPEASRLNPLDRSLSRALVTMWVNFATTGVPNPSSG
VWPQATSE
YGPFLRFTNNQQSPLELDPHFGEGIYLPNYRVIYKPTTNFSP
PITTTTTTTTTTTTT
SRPYAYNPYANWQNRPSQQHPNWHPADPEYVRAQE
ARQQEFIREREQRRREQQLRDQQRYPQQEPREQQDERIRQQREQEERLRQ
QREQEERLRQQRELEERIRQQQEREQYEREQQEREQREREELERQQRER
E
QQQPEQQPEYNPEPVNPWGYPVQEPQPDDNPEDGRLPYPSYEQYGPEGNE
NLPETDANRNFSEEDREQQQQEQLRREQQEQQEREYQLQLEREQQEREQQ
ERGQQEPGPEEYPSYEEYSRALQEKNAERDRIYAEEQERERQQQETLLQE
NQQHPEQSLPEEQPTHPNYEAYDGDRSYAEEQEREQQRRDQVEQEREEQP
DEDQGEEYERSPDEEEAAEQDVLKVEDFPSYEAYLEAATKLREEQEEQEK
LEEERYRAQQEEEDRIQAERERNSRN
Original MKPLLLVLALCGAQVHAHSVGLRPDYNDYSDEDTRRDWLPEPLKPVPWQS
ETRYAQPQEAVVQAPEVGQILGISGHKTIANRPVNAFLGIRYGTVGGGLA
RFQAAQPIGYQGRVNATVQSPNCAQFPELDRLRLSESRGENVDDCLTLDI
YAPEGANQLPVLVFVHGEMLFDGGSEEAQPDYVLEKDVLLVSINYRLAPF
GFLSALTDELPGNVALSDLQLALEWLQRNVVHFGGNAGQVTLVGQAGGAT
LAHALSLSGRAGNLFQQLILQSGTALNPYLIDNQPLDTLSTFARLARCPP
PSINPSAQGLKPLYDCLARLPTSQLVAAFEQLLLQNEHLGLTQLGGFKLV
VGDPLGFLPSHPASLATNSSLALPMIIGATKDASAFIVSRIYDQLARLQS
RNVSDYIDVVLRHTAPPSEHRLWKQWALREIFTPIQEQTASLQTVAPGLL
ELSNYILYRAPVINSISQSYRSVPAYLYTFDYRGEHHRFGHLSNPLPFGV
DASLSDDSVYLFPYPPEASRLNPLDRSLSRALVTMWVNFATTGVPNPSSG
VWPQATSEYGPFLRFTNNQQSPLELDPHFGEGIYLPNYRVIYKPTTNFSP
PITTTTTTTTTTTTTSRPYAYNPYANWQNRPSQQHPNWHPADPEYVRAQE
ARQQEFIREREQRRREQQLRDQQRYPQQEPREQQDERIRQQREQEERLRQ
QREQEERLRQQRELEERIRQQQEREQYEREQQEREQREREELERQQRERE
QQQPEQQPEYNPEPVNPWGYPVQEPQPDDNPEDGRLPYPSYEQYGPEGNE
NLPETDANRNFSEEDREQQQQEQLRREQQEQQEREYQLQLEREQQEREQQ
ERGQQEPGPEEYPSYEEYSRALQEKNAERDRIYAEEQERERQQQETLLQE
NQQHPEQSLPEEQPTHPNYEAYDGDRSYAEEQEREQQRRDQVEQEREEQP
DEDQGEEYERSPDEEEAAEQDVLKVEDFPSYEAYLEAATKLREEQEEQEK
LEEERYRAQQEEEDRIQAERERNSRN
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11