Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   40
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   O76264    (Created: 2001-09-26 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   AMYR_DROYA
Protein Name   Alpha-amylase-related protein
Gene   Amyrel
Organism Scientific   Drosophila yakuba
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   493
Protein Mass [Da]   55420
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   19
chain   Alpha-amylase-related protein      20   493
disulfide bond      by similarity   47   103
disulfide bond      by similarity   156   170
disulfide bond      by similarity   375   381
disulfide bond      potential   417   440
disulfide bond      by similarity   447   459
modified residue   Pyrrolidone carboxylic acid   by similarity   20   20
sequence variant   (in strain: LO4, LBV2, SA3, SA4)      0   0
sequence variant   (in strain: SA3)      0   0
sequence variant   (in strain: LBV2)      0   0
sequence variant   (in strain: LBV2, SA3, SA4)      0   0
sequence variant   (in strain: LBV2, SA3, SA4)      0   0
sequence variant   (in strain: LO4, LBV2, SA3, SA4)      0   0
sequence variant   (in strain: LBV2, SA3, SA4)      0   0
sequence variant   (in strain: LO4, LBV2, SA3, SA4)      0   0
sequence variant   (in strain: LO4)      0   0
active site   Nucleophile   by similarity   207   207
active site   Proton donor   by similarity   244   244
active site      by similarity   309   309
metal ion-binding site   Calcium   by similarity   117   117
metal ion-binding site   Calcium; via carbonyl oxygen   by similarity   168   168
metal ion-binding site   Calcium   by similarity   177   177
metal ion-binding site   Calcium; via carbonyl oxygen   by similarity   211   211
binding site   Chloride   by similarity   205   205
binding site   Chloride   by similarity   307   307
binding site   Chloride   by similarity   342   342
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MFKLALTLTLCLAGSLSLA
Sequence MFKLALTLTLCLAGSLSLAQHNPHWWGNRNTIVHLFEWKWSDIAQECENF
LGPRGFAGVQVSPVNENIISAGRPWWERYQPISYKLTTRSGNEEEFGDMV
RRC
NDVGVRIYVDVLLNHMSGDFDGVAVGTAGTEAEPGKKSFPGVPYSAQ
DFHPT
CEITDWNDRFQVQQCELVGLKDLDQSSDWVRSKPIEFLDHLIELG
VAGF
RVDAAKHMASEDLEYIYSSLSNLNIDHGFPHNARPFIFQEVIDHGH
ETVSRDEYKDLGAVTEFRFSEEIGNAFRGNNALKWLQSWGTGWGFLPSGQ
ALTFVD
NHDNQRDAGAVLNYKSPKQYKMATAFHLAYPYGISRVMSSFAFD
DHDTPPPQDAQERIISPEFDEDGA
CVNGWICEHRWRQIYAMVGFKNAVRD
TEITGWWDNGDNQISF
CRGNKGFLAINNNLYDLSQDLNTCLPQGTYCDVI
SGSLIDGSC
TGKSVTVNEHGYGYIHIGSDDFDGVLALHVDAKV
Original MFKLALTLTLCLAGSLSLAQHNPHWWGNRNTIVHLFEWKWSDIAQECENF
LGPRGFAGVQVSPVNENIISAGRPWWERYQPISYKLTTRSGNEEEFGDMV
RRCNDVGVRIYVDVLLNHMSGDFDGVAVGTAGTEAEPGKKSFPGVPYSAQ
DFHPTCEITDWNDRFQVQQCELVGLKDLDQSSDWVRSKPIEFLDHLIELG
VAGFRVDAAKHMASEDLEYIYSSLSNLNIDHGFPHNARPFIFQEVIDHGH
ETVSRDEYKDLGAVTEFRFSEEIGNAFRGNNALKWLQSWGTGWGFLPSGQ
ALTFVDNHDNQRDAGAVLNYKSPKQYKMATAFHLAYPYGISRVMSSFAFD
DHDTPPPQDAQERIISPEFDEDGACVNGWICEHRWRQIYAMVGFKNAVRD
TEITGWWDNGDNQISFCRGNKGFLAINNNLYDLSQDLNTCLPQGTYCDVI
SGSLIDGSCTGKSVTVNEHGYGYIHIGSDDFDGVLALHVDAKV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11