Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   41
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8WSV4    (Created: 2002-11-15 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ANDP_DROSI
Protein Name   Andropin
Gene   Anp
Organism Scientific   Drosophila simulans
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   60
Protein Mass [Da]   6431
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   23
sequence variant   (in strain: New Caledonia)      0   0
sequence variant   (in strain: New Caledonia)      0   0
peptide   Andropin. /FTId=PRO_0000004955      24   60
SP Length   23
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKYFVVLVVLALILAIAVGPSDA
Sequence MKYFVVLVVLALILAIAVGPSDAVFIDILDKMENAIHKAAQAGIGIAKPI
ENMILPKLTK
Original MKYFVVLVVLALILAIAVGPSDAVFIDILDKMENAIHKAAQAGIGIAKPI
ENMILPKLTK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11