Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   413
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q08180    (Created: 1995-02-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   ICCR_DROME
Protein Name   Irregular chiasm C-roughest protein
Gene   rst
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   764
Protein Mass [Da]   83005
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Irregular chiasm C-roughest protein      20   764
disulfide bond      by similarity   49   107
disulfide bond      by similarity   155   214
disulfide bond      by similarity   281   325
disulfide bond      by similarity   367   408
disulfide bond      by similarity   450   508
transmembrane region      potential   534   556
topological domain   Extracellular   potential   20   533
topological domain   Cytoplasmic   potential   557   764
domain   Ig-like C2-type 1      21   120
domain   Ig-like C2-type 2      132   230
domain   Ig-like C2-type 3      237   343
domain   Ig-like C2-type 4      346   419
domain   Ig-like C2-type 5      430   530
glycosylation site   N-linked (GlcNAc...)   potential   211   211
glycosylation site   N-linked (GlcNAc...)   potential   313   313
glycosylation site   N-linked (GlcNAc...)   potential   393   393
glycosylation site   N-linked (GlcNAc...)   potential   400   400
glycosylation site   N-linked (GlcNAc...)   potential   507   507
compositionally biased region   Gly-rich      245   261
compositionally biased region   Gln-rich (OPA repeat)      637   660
compositionally biased region   Poly-Thr      721   725
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLHTMQLLLLATIVGMVRS
Sequence MLHTMQLLLLATIVGMVRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCR
VINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLD
DDARYQCQVSPGPEGQPAIR
STFAGLTVLVPPEAPKITQGDVIYATEDRK
VEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLR
LTPKKEHHNT
NFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGG
AGGSVGGAGGG
SVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEP
IIGGQKTEMVIR
NVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQ
RPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTST
NLTFSVSN
ETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIEC
FASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQA
YHYGKY
NCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTI
LVVVYI
KCKKRTKLPPADVISEHQITKNGGVSCKLEPGDRTSNYSDLKVD
ISGGYVPYGDYSTHYSPPPQYLTTCSTKSNGSSTIM
QNNHQNQLQLQQQQ
QQSHHQHHTQ
TTTLPMTFLTNSSGGSLTGSIIGSREIRQDNGLPSLQSTT
ASVVSSSPNGSCSNQSTTAA
TTTTTHVVVPSSMALSVDPRYSAIYGNPYL
RSSNSSLLPPPTAV
Original MLHTMQLLLLATIVGMVRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCR
VINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLD
DDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRK
VEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLR
LTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGG
AGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEP
IIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQ
RPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTFSVSN
ETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIEC
FASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQA
YHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTI
LVVVYIKCKKRTKLPPADVISEHQITKNGGVSCKLEPGDRTSNYSDLKVD
ISGGYVPYGDYSTHYSPPPQYLTTCSTKSNGSSTIMQNNHQNQLQLQQQQ
QQSHHQHHTQTTTLPMTFLTNSSGGSLTGSIIGSREIRQDNGLPSLQSTT
ASVVSSSPNGSCSNQSTTAATTTTTHVVVPSSMALSVDPRYSAIYGNPYL
RSSNSSLLPPPTAV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11