Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   415
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8MX31    (Created: 2004-03-15 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   IDGF3_DROYA
Protein Name   Chitinase-like protein Idgf3
Gene   Idgf3
Organism Scientific   Drosophila yakuba
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   441
Protein Mass [Da]   49193
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   23
chain   Chitinase-like protein Idgf3      24   441
disulfide bond      by similarity   29   56
disulfide bond      by similarity   342   425
glycosylation site   N-linked (GlcNAc...)   by similarity   221   221
SP Length   23
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MTGSLWLSLALSLAVLAQFKVSA
Sequence MTGSLWLSLALSLAVLAQFKVSAAPNLVCFYDSQGFQRQGLAQFSMTDME
LALQFC
THLVYGYAGVNADNYEMQSINKRLDLEQRHLAQVSSLKERYPHI
KFLLSVGGDADTNEGNQYIKLLESGQQGHRRFIESARDLVRRYNFDGLDL
ALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTDSETHKGQVTALIKD
LSAALKQNDLLLSLTVLPNV
NSSWYYDAPSIAPSLDFINLGTFDFLTPQR
NPEEADFSAPTYEAVGQNRLGHYNLNFQTEHWLLQRVPANKINIGIATYG
RTWKMTKDSGDSGMPVVPSTQGPAPAGPQSKKEGLLNWAEI
CSLMPNPGN
TNARGPSAPVKRVLDPTKRYGSYAFRAADENGDHGLWISYDDPDSASSKA
MFARVRNLGGVALFDLTQDDFRGQC
TNDRFPMLRAIKYRLL
Original MTGSLWLSLALSLAVLAQFKVSAAPNLVCFYDSQGFQRQGLAQFSMTDME
LALQFCTHLVYGYAGVNADNYEMQSINKRLDLEQRHLAQVSSLKERYPHI
KFLLSVGGDADTNEGNQYIKLLESGQQGHRRFIESARDLVRRYNFDGLDL
ALQLPRNKPRKVHGDVGSAWKSFKKFFTGDFIVDTDSETHKGQVTALIKD
LSAALKQNDLLLSLTVLPNVNSSWYYDAPSIAPSLDFINLGTFDFLTPQR
NPEEADFSAPTYEAVGQNRLGHYNLNFQTEHWLLQRVPANKINIGIATYG
RTWKMTKDSGDSGMPVVPSTQGPAPAGPQSKKEGLLNWAEICSLMPNPGN
TNARGPSAPVKRVLDPTKRYGSYAFRAADENGDHGLWISYDDPDSASSKA
MFARVRNLGGVALFDLTQDDFRGQCTNDRFPMLRAIKYRLL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11