Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   444
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q24247    (Created: 1997-11-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   ITA1_DROME
Protein Name   Integrin alpha-PS1
Gene   mew
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   1146
Protein Mass [Da]   127973
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   30
chain   Integrin alpha-PS1      31   1146
chain   Integrin alpha-PS1 heavy chain   potential   31   960
chain   Integrin alpha-PS1 light chain   potential   961   1146
transmembrane region      potential   1086   1106
topological domain   Extracellular   potential   31   1085
topological domain   Cytoplasmic   potential   1107   1146
glycosylation site   N-linked (GlcNAc...)   potential   68   68
glycosylation site   N-linked (GlcNAc...)   potential   86   86
glycosylation site   N-linked (GlcNAc...)   potential   147   147
glycosylation site   N-linked (GlcNAc...)   potential   470   470
glycosylation site   N-linked (GlcNAc...)   potential   511   511
glycosylation site   N-linked (GlcNAc...)      657   657
glycosylation site   N-linked (GlcNAc...)   potential   680   680
glycosylation site   N-linked (GlcNAc...)   potential   711   711
glycosylation site   N-linked (GlcNAc...)   potential   718   718
glycosylation site   N-linked (GlcNAc...)   potential   761   761
glycosylation site   N-linked (GlcNAc...)   potential   928   928
glycosylation site   N-linked (GlcNAc...)      1027   1027
repeat   FG-GAP 1      49   116
repeat   FG-GAP 2      117   0
repeat   FG-GAP 3      199   263
repeat   FG-GAP 4      264   317
repeat   FG-GAP 5      318   374
repeat   FG-GAP 6      377   434
repeat   FG-GAP 7      443   497
splice variant   (in isoform A)      1   97
SP Length   30
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLELPFTTIRPNCRLRQNLGILIILQCVLT
Sequence MLELPFTTIRPNCRLRQNLGILIILQCVLTCYNFNLEQRLPIVKYGHPHS
HFGYSVATHTIGEANGPNKTNCVLVGAPLDQNRQPNTTHSGALWRCP
MTQ
RFDDCEQVITDGRRNF
DSEILSPPGNDEIKEDQWMGVTVRSNPLQANGSG
GKVIVCAHRYMYIVRENRYGQGLCYLLTNDLQFEEVHEPCKGRPVQRQ
HE
DYGLCQAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTY
YSDHSDLNSPVDK
YSYLGMSVTGGRFFGHMSYAAGAPRSEGHGQVVIFDK
STDNPIPVHSILDGEQF
GSSFGYELATADINGDHRPDLIVAAPLYFTKTE
GGAVYVYQNIQDTLPMKYTLKLTG
PLESRFGLALANIGDLNKDNCEDLAV
GAPYEGNGVVYIYLGSSQGLNSKPAQKIQASELG
GTIPNGQPIRTFGISI
SGNTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSVQRKELHNM
DPN
TPGCLDDPAS
NLTCFTFRACCSIEPYDEKNKELRLAYSVEAETFDHLKKF
SRVFFFDRENKRTNVLSRVVRVHTNGRTECQAVTGYIKANTRDIQTPVRF
RLKYSLVEPPLADSALVRLNPILDQTQAHVDFEGTFQKDCGDDDLCESNL
IIRVEP
NITESSGNEYTLILDETELEVRINVSNLADSAYEAQLFIAHQAG
VSYVATKKPT
NATCNSYNTTLVACSLGNPMLRDTTTFVTIRFQPKGLEPS
EKIMLFHIFA
NTTSKLVGPERPERDLRVNVVRRAKLNFRGWAIPEQSFYS
GSSVANSVANTAATDIEGHGPMGMDDVGSQVHHMFTIFNEGPSTAPKVQM
VIHWPYSLYSDPQSGRPVQYLLYLEQVPTVEVSQGECHVAKEYVNPLNLA
SGSRENPAYLSAPAQMRMFPSQSRHSF
NKSLIHSQRSYYSSSHRDDHSDD
TQSNRNRVRRSFLERVTRLERLMYDPESSNAANGKKQDIVELDCNKGATN
CVRIECDILNMPALSEAQVVVKARLW
NSTLVSEYPRVERVRIFSTATAQI
PESYGVEVMDHNNIEVETRAYPELRNQQRDTSIPW
LIIILGIVGGLLLLA
LVTYVL
WKVGFFKRIRPTDPTLSGNLEKMNEEKPFLAPSKNTHHVF
Original MLELPFTTIRPNCRLRQNLGILIILQCVLTCYNFNLEQRLPIVKYGHPHS
HFGYSVATHTIGEANGPNKTNCVLVGAPLDQNRQPNTTHSGALWRCPMTQ
RFDDCEQVITDGRRNFDSEILSPPGNDEIKEDQWMGVTVRSNPLQANGSG
GKVIVCAHRYMYIVRENRYGQGLCYLLTNDLQFEEVHEPCKGRPVQRQHE
DYGLCQAGTSAALLDDDTMVLGSPGPYTWRGSIWVTQVGGEYLQRDKTTY
YSDHSDLNSPVDKYSYLGMSVTGGRFFGHMSYAAGAPRSEGHGQVVIFDK
STDNPIPVHSILDGEQFGSSFGYELATADINGDHRPDLIVAAPLYFTKTE
GGAVYVYQNIQDTLPMKYTLKLTGPLESRFGLALANIGDLNKDNCEDLAV
GAPYEGNGVVYIYLGSSQGLNSKPAQKIQASELGGTIPNGQPIRTFGISI
SGNTDLDDNSYPDVVIGAFNSSAAVILLARPIISIQTSVQRKELHNMDPN
TPGCLDDPASNLTCFTFRACCSIEPYDEKNKELRLAYSVEAETFDHLKKF
SRVFFFDRENKRTNVLSRVVRVHTNGRTECQAVTGYIKANTRDIQTPVRF
RLKYSLVEPPLADSALVRLNPILDQTQAHVDFEGTFQKDCGDDDLCESNL
IIRVEPNITESSGNEYTLILDETELEVRINVSNLADSAYEAQLFIAHQAG
VSYVATKKPTNATCNSYNTTLVACSLGNPMLRDTTTFVTIRFQPKGLEPS
EKIMLFHIFANTTSKLVGPERPERDLRVNVVRRAKLNFRGWAIPEQSFYS
GSSVANSVANTAATDIEGHGPMGMDDVGSQVHHMFTIFNEGPSTAPKVQM
VIHWPYSLYSDPQSGRPVQYLLYLEQVPTVEVSQGECHVAKEYVNPLNLA
SGSRENPAYLSAPAQMRMFPSQSRHSFNKSLIHSQRSYYSSSHRDDHSDD
TQSNRNRVRRSFLERVTRLERLMYDPESSNAANGKKQDIVELDCNKGATN
CVRIECDILNMPALSEAQVVVKARLWNSTLVSEYPRVERVRIFSTATAQI
PESYGVEVMDHNNIEVETRAYPELRNQQRDTSIPWLIIILGIVGGLLLLA
LVTYVLWKVGFFKRIRPTDPTLSGNLEKMNEEKPFLAPSKNTHHVF
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11