Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   527
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P29615    (Created: 1993-04-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   LYSP_DROME
Protein Name   Lysozyme P
Gene   LysP
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   141
Protein Mass [Da]   15648
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   18
chain   Lysozyme P      19   141
disulfide bond      by similarity   25   140
disulfide bond      by similarity   46   130
disulfide bond      by similarity   81   97
disulfide bond      by similarity   93   111
active site      by similarity   51   51
active site      by similarity   69   69
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKAFLVICALTLTAVATQ
Sequence MKAFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQH
ESSFRTGVVGPANSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNAL
LTDDITNSVKC
ARKIQRQQGWTAWSTWKYCSGSLPSINSCF
Original MKAFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQH
ESSFRTGVVGPANSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNAL
LTDDITNSVKCARKIQRQQGWTAWSTWKYCSGSLPSINSCF
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11