Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   533
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P07190    (Created: 1988-04-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   MAL2_DROME
Protein Name   Probable maltase H
Gene   LvpH
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   577
Protein Mass [Da]   66386
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Probable maltase H      20   577
glycosylation site   N-linked (GlcNAc...)   potential   119   119
glycosylation site   N-linked (GlcNAc...)   potential   151   151
glycosylation site   N-linked (GlcNAc...)   potential   244   244
glycosylation site   N-linked (GlcNAc...)   potential   315   315
glycosylation site   N-linked (GlcNAc...)   potential   331   331
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MRPQSAACLLLAIVGFVGA
Sequence MRPQSAACLLLAIVGFVGATEWWESGNYYQIYPRSFRDSDGDGIGDLNGV
TEKLQYLKDIGFTGTWLSPIFKSPMVDFGYDISDFYQIHPEYGTMEDFER
MIAKAKEVGIKIILDFVP
NHSSTENEWFTKSVDSDPVYKDFYIWHDGKIN
NETGEREPPSNWNSEFRYSAWEWNEVRQQYYLHQFAIQQADLNYRNPAVV
NEMKNVIRFWLGKGVSGFRIDAVPYLFEVDLDRYNQYPDEPLT
NDSVNCP
DPDDHCYTQHIYTQDMPETIDMVYQWRELVDEFHVENGGDKRLLMTEAYT
SFENIMTYYGNGVR
NGSHIPFNFDFLTSINNASKAGEYVEHIKKWMDAMP
EGVYANWVLGNHDNKRVASRFGVQRTDLINILLQTLPGHAVTYNGEELGM
TDVWISWEDTVDPNACNSDPDNYYARSRDPARSPYQWDASSKAGFTSADH
TWLPVADDYKTNNALQQLRAPRSHLQIFKKLVRVRKEPSFRQGELNIQAI
DDDVIIYSRQKTGSDLYVIVLNLGSTSKTLDLTKYYELGTQAEVITTSLS
SQYIDGDVIKSTEFVANPYVGTVLVAV
Original MRPQSAACLLLAIVGFVGATEWWESGNYYQIYPRSFRDSDGDGIGDLNGV
TEKLQYLKDIGFTGTWLSPIFKSPMVDFGYDISDFYQIHPEYGTMEDFER
MIAKAKEVGIKIILDFVPNHSSTENEWFTKSVDSDPVYKDFYIWHDGKIN
NETGEREPPSNWNSEFRYSAWEWNEVRQQYYLHQFAIQQADLNYRNPAVV
NEMKNVIRFWLGKGVSGFRIDAVPYLFEVDLDRYNQYPDEPLTNDSVNCP
DPDDHCYTQHIYTQDMPETIDMVYQWRELVDEFHVENGGDKRLLMTEAYT
SFENIMTYYGNGVRNGSHIPFNFDFLTSINNASKAGEYVEHIKKWMDAMP
EGVYANWVLGNHDNKRVASRFGVQRTDLINILLQTLPGHAVTYNGEELGM
TDVWISWEDTVDPNACNSDPDNYYARSRDPARSPYQWDASSKAGFTSADH
TWLPVADDYKTNNALQQLRAPRSHLQIFKKLVRVRKEPSFRQGELNIQAI
DDDVIIYSRQKTGSDLYVIVLNLGSTSKTLDLTKYYELGTQAEVITTSLS
SQYIDGDVIKSTEFVANPYVGTVLVAV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11