Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   570
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P83120    (Created: 2001-11-02 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   MTH_DROSI
Protein Name   G-protein coupled receptor Mth
Gene   mth
Organism Scientific   Drosophila simulans
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   515
Protein Mass [Da]   59601
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   24
chain   G-protein coupled receptor Mth      25   515
disulfide bond      by similarity   29   83
disulfide bond      by similarity   85   90
disulfide bond      by similarity   94   188
disulfide bond      by similarity   95   106
disulfide bond      by similarity   150   209
transmembrane region   1   potential   219   239
transmembrane region   2   potential   249   269
transmembrane region   3   potential   279   299
transmembrane region   4   potential   321   341
transmembrane region   5   potential   371   391
transmembrane region   6   potential   425   445
transmembrane region   7   potential   455   475
topological domain   Extracellular   potential   25   218
topological domain   Cytoplasmic   potential   240   248
topological domain   Extracellular   potential   270   278
topological domain   Cytoplasmic   potential   300   320
topological domain   Extracellular   potential   342   370
topological domain   Cytoplasmic   potential   392   424
topological domain   Extracellular   potential   446   454
topological domain   Cytoplasmic   potential   476   515
glycosylation site   N-linked (GlcNAc...)   by similarity   45   45
glycosylation site   N-linked (GlcNAc...)   potential   109   109
glycosylation site   N-linked (GlcNAc...)   by similarity   123   123
glycosylation site   N-linked (GlcNAc...)   by similarity   170   170
glycosylation site   N-linked (GlcNAc...)   potential   198   198
glycosylation site   N-linked (GlcNAc...)   potential   449   449
sequence variant   (in strain: HFL4.1S)      0   0
sequence variant   (in strain: HFL2.1S, VA7.1S, VA8.1S)      0   0
sequence variant   (in strain: GA2.1S)      0   0
sequence variant   (in strain: CT2.1S, CT5.1S, CT6.1S, VA6.1S)      0   0
sequence variant   (in strain: HFL2.1S, HFL4.1S, VA8.1S)      0   0
sequence variant   (in strain: GA2.1S, HFL2.1S, HFL4.1S, VA8.1S)      0   0
sequence variant   (in strain: GA2.1S, HFL2.1S, HFL4.1S)      0   0
sequence variant   (in strain: GA2.1S, GA4.1S, GA5.1S, HFL1.1S, HFL2.1S, HFL4.1S, VA7.1S, VA8.1S)      0   0
SP Length   24
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKTLFVLRISTVILVVLVIQKSYA
Sequence MKTLFVLRISTVILVVLVIQKSYADILECDYFDTVDISAAQKLQNGSYLF
EGLLVPAILTGEYDFRILPDDSKQKVASHIRGCVCKLKPCVRFCCPHDHI
MDNGVCND
NMSEEELTELDPFLNVTLDDGSVSRRHFKNELIVQWDLPMPC
DGMFYLDNREEQDQYTLFE
NGTFFRHFDRVTLSKREYCLQHLTFADGNAT
SIRIAPHNCLIVPSITGQ
TVVMITSLICMVLTIAVYLFVKKLQNLHGKCF
ICYMVCLFMGYLFLLFDLW
QISISFCKPAGVLGYFFVMAAFLWLSVISLH
LWNTFRGSSHKASRFFSEHR
FLAYNTYAWGMSMVLTGITVLADNVVEDQD
WNPRVGEEGHCWIYTQAWSA
MLYFYGPMVFLIAFNITMFILTARRIIGVK
KDIQNFAHRQERKQKLNSDKQTYT
FFLRLFIIMGLSWSLEIGSYISQSNQ
TWAN
VFLVADYLNWSQGIIIFILFILKRSTLRLLQESIRGEGEEVDNSEE
EISLENTRFDRNVLS
Original MKTLFVLRISTVILVVLVIQKSYADILECDYFDTVDISAAQKLQNGSYLF
EGLLVPAILTGEYDFRILPDDSKQKVASHIRGCVCKLKPCVRFCCPHDHI
MDNGVCNDNMSEEELTELDPFLNVTLDDGSVSRRHFKNELIVQWDLPMPC
DGMFYLDNREEQDQYTLFENGTFFRHFDRVTLSKREYCLQHLTFADGNAT
SIRIAPHNCLIVPSITGQTVVMITSLICMVLTIAVYLFVKKLQNLHGKCF
ICYMVCLFMGYLFLLFDLWQISISFCKPAGVLGYFFVMAAFLWLSVISLH
LWNTFRGSSHKASRFFSEHRFLAYNTYAWGMSMVLTGITVLADNVVEDQD
WNPRVGEEGHCWIYTQAWSAMLYFYGPMVFLIAFNITMFILTARRIIGVK
KDIQNFAHRQERKQKLNSDKQTYTFFLRLFIIMGLSWSLEIGSYISQSNQ
TWANVFLVADYLNWSQGIIIFILFILKRSTLRLLQESIRGEGEEVDNSEE
EISLENTRFDRNVLS
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11