Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   671
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9W1C9    (Created: 2003-03-28 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   PEB3_DROME
Protein Name   Ejaculatory bulb-specific protein 3
Gene   PebIII
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   126
Protein Mass [Da]   14540
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   17
chain   Ejaculatory bulb-specific protein 3      18   126
SP Length   17
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKMILALVVLGLVLVAA
Sequence MKMILALVVLGLVLVAAEDKYTTKYDNIDVDEILKSDRLFGNYFKCLVDN
GKCTPEGRELKKSLPDALKTECSKCSEKQRQNTDKVIRYIIENKPEEWKQ
LQAKYDPDEIYIKRYRATAEASGIKV
Original MKMILALVVLGLVLVAAEDKYTTKYDNIDVDEILKSDRLFGNYFKCLVDN
GKCTPEGRELKKSLPDALKTECSKCSEKQRQNTDKVIRYIIENKPEEWKQ
LQAKYDPDEIYIKRYRATAEASGIKV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11