Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   680
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9VEG6    (Created: 2006-04-18 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   PERC_DROME
Protein Name   Chorion peroxidase
Gene   pxt
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   831
Protein Mass [Da]   93000
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
chain   Chorion peroxidase light chain      224   343
chain   Chorion peroxidase heavy chain      344   831
disulfide bond      by similarity   230   244
disulfide bond      by similarity   448   457
disulfide bond      by similarity   787   816
modified residue   N-acetylcysteine   by similarity   224   224
glycosylation site   N-linked (GlcNAc...)   potential   110   110
site   Transition state stabilizer   by similarity   464   464
active site   Proton acceptor   by similarity   320   320
splice variant   (in isoform B)      462   483
propeptide      by similarity   22   223
metal ion-binding site   Iron (heme axial ligand)   by similarity   590   590
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MSRILFILLLLIVTQLSELQA
Sequence MSRILFILLLLIVTQLSELQAAAFSVRQNRFDEVPDLQTPAPLATSTESS
KKPEKATSGLLKKCLPCSDGIRCVPQIQCPAHVRMESHEKPQICDLPAGK
FGYCCETGQNHTAPKPETSPKERRSGFPTILSPAVLDEARRNFEHLMHGV
AQIPVRRGFPDFAHGLVFHSTAKDDLHNFAISNSAIEQVMTTQLFGKKEQ
VPVEDFITNNVPIKFTETPLAHH
CQPPPVCGNIRSVYRSMDGTCNNPEPQ
RSLWGAAGQPMERMLPPAYEDGIWTPRAHSSDGTPLLGARKISRTLLSDV
DRPHPKYNLMVMQFGQVLA
HDISQTSSIRLEDGSLVQCCSPEGKVALSPQ
QSHFACMPIHVEPDDEFFSAFGVRCLNFVRLSLVPSPDCQLSYGKQLTKV
THFVDASPVYGSSDEASRSLRAFRGGRLRMMNDFGRDLLPLTNDKKA
CPS
EEAGKSC
FHSGKSLLSNVFLIINSLITYLTRLGDGRTNQIISLITLQILL
AREHNRVAGALHELNPSASDETLFQEARRIVIAEMQHITYNEFLPIIIGP
QQMKRFRLVPLHQGYSHDYNVNVNPAITNEFSGAAYRMG
HSSVDGKFQIR
QEHGRIDEVVNIPDVMFNPSRMRKREFYDDMLRTLYSQPMQQVDSSISQG
LSRFLFRGDNPFGLDLAAINIQRGRDQGLRSYNDYLELMGAPKLHSFEQF
PIEIAQKLSRVYRTPDDIDLWVGGLLEKAVEGGVVGVTFAEIIADQFARF
KQGDRYYYEYDNGINPGAFNPLQLQEIRKVTLARLL
CDNSDRLTLQAVPL
AAFVRADHPGNQMIGC
DDPNLPSVNLEAWRA
Original MSRILFILLLLIVTQLSELQAAAFSVRQNRFDEVPDLQTPAPLATSTESS
KKPEKATSGLLKKCLPCSDGIRCVPQIQCPAHVRMESHEKPQICDLPAGK
FGYCCETGQNHTAPKPETSPKERRSGFPTILSPAVLDEARRNFEHLMHGV
AQIPVRRGFPDFAHGLVFHSTAKDDLHNFAISNSAIEQVMTTQLFGKKEQ
VPVEDFITNNVPIKFTETPLAHHCQPPPVCGNIRSVYRSMDGTCNNPEPQ
RSLWGAAGQPMERMLPPAYEDGIWTPRAHSSDGTPLLGARKISRTLLSDV
DRPHPKYNLMVMQFGQVLAHDISQTSSIRLEDGSLVQCCSPEGKVALSPQ
QSHFACMPIHVEPDDEFFSAFGVRCLNFVRLSLVPSPDCQLSYGKQLTKV
THFVDASPVYGSSDEASRSLRAFRGGRLRMMNDFGRDLLPLTNDKKACPS
EEAGKSCFHSGKSLLSNVFLIINSLITYLTRLGDGRTNQIISLITLQILL
AREHNRVAGALHELNPSASDETLFQEARRIVIAEMQHITYNEFLPIIIGP
QQMKRFRLVPLHQGYSHDYNVNVNPAITNEFSGAAYRMGHSSVDGKFQIR
QEHGRIDEVVNIPDVMFNPSRMRKREFYDDMLRTLYSQPMQQVDSSISQG
LSRFLFRGDNPFGLDLAAINIQRGRDQGLRSYNDYLELMGAPKLHSFEQF
PIEIAQKLSRVYRTPDDIDLWVGGLLEKAVEGGVVGVTFAEIIADQFARF
KQGDRYYYEYDNGINPGAFNPLQLQEIRKVTLARLLCDNSDRLTLQAVPL
AAFVRADHPGNQMIGCDDPNLPSVNLEAWRA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11