Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   690
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q70PY2    (Created: 2005-05-10 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   PGSB1_DROME
Protein Name   Peptidoglycan-recognition protein-SB1
Gene   PGRP-SB1
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   190
Protein Mass [Da]   20998
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   24
chain   Peptidoglycan-recognition protein-SB1      25   190
disulfide bond      by similarity   62   68
glycosylation site   N-linked (GlcNAc...)   potential   2   2
glycosylation site   N-linked (GlcNAc...)   potential   84   84
glycosylation site   N-linked (GlcNAc...)   potential   158   158
sequence variant   (in strain: DI7, KY038, Loua)      0   0
sequence variant   (in strain: DI7, Loua, S30)      0   0
sequence variant   (in strain: DI7, Loua, Monty5, Tahiti, ZW141)      0   0
metal ion-binding site   Zinc   by similarity   55   55
metal ion-binding site   Zinc   by similarity   90   90
metal ion-binding site   Zinc   by similarity   164   164
metal ion-binding site   Zinc   by similarity   172   172
SP Length   24
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNTSTAISFVAALVLCCLALSANA
Sequence MNTSTAISFVAALVLCCLALSANALQIEPRSSWGAVSARSPSRISGAVDY
VIIH
HSDNPNGCSTSEQCKRMIKNIQSDHKGRRNFSDIGYNFIVAGDGKV
YEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPSAQMLQNAKDLIELAK
QRGYLKD
NYTLFGHRQTKATSCPGDALYNEIKTWPHWRQN
Original MNTSTAISFVAALVLCCLALSANALQIEPRSSWGAVSARSPSRISGAVDY
VIIHHSDNPNGCSTSEQCKRMIKNIQSDHKGRRNFSDIGYNFIVAGDGKV
YEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPSAQMLQNAKDLIELAK
QRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWRQN
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11