Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   710
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q868Z9    (Created: 2006-09-05 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   PPN_DROME
Protein Name   Papilin
Gene   Ppn
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   2898
Protein Mass [Da]   313035
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   26
chain   Papilin      27   2898
disulfide bond      by similarity   69   105
disulfide bond      by similarity   73   110
disulfide bond      by similarity   84   95
disulfide bond      by similarity   462   504
disulfide bond      by similarity   473   515
disulfide bond      by similarity   477   520
disulfide bond      by similarity   1612   1662
disulfide bond      by similarity   1621   1645
disulfide bond      by similarity   1637   1658
disulfide bond      by similarity   1671   1721
disulfide bond      by similarity   1680   1704
disulfide bond      by similarity   1696   1717
disulfide bond      by similarity   1730   1780
disulfide bond      by similarity   1739   1763
disulfide bond      by similarity   1755   1776
disulfide bond      by similarity   1790   1840
disulfide bond      by similarity   1799   1823
disulfide bond      by similarity   1815   1836
disulfide bond      by similarity   1849   1899
disulfide bond      by similarity   1858   1882
disulfide bond      by similarity   1874   1895
disulfide bond      by similarity   1922   1972
disulfide bond      by similarity   1931   1955
disulfide bond      by similarity   1947   1968
disulfide bond      by similarity   2001   2051
disulfide bond      by similarity   2010   2034
disulfide bond      by similarity   2026   2047
disulfide bond      by similarity   2071   2121
disulfide bond      by similarity   2080   2104
disulfide bond      by similarity   2096   2117
disulfide bond      by similarity   2128   2178
disulfide bond      by similarity   2137   2161
disulfide bond      by similarity   2153   2174
disulfide bond      by similarity   2194   2244
disulfide bond      by similarity   2203   2227
disulfide bond      by similarity   2219   2240
disulfide bond      by similarity   2253   2303
disulfide bond      by similarity   2262   2286
disulfide bond      by similarity   2278   2299
disulfide bond      by similarity   2318   2371
disulfide bond      by similarity   2327   2354
disulfide bond      by similarity   2346   2367
disulfide bond      by similarity   2543   2592
disulfide bond      by similarity   2640   2687
disulfide bond      by similarity   2775   2824
domain   TSP type-1 1      57   111
domain   TSP type-1 2      338   397
domain   TSP type-1 3      461   521
domain   TSP type-1 4      522   575
domain   TSP type-1 5      576   633
domain   TSP type-1 6      639   694
domain   BPTI/Kunitz inhibitor 1      1612   1662
domain   BPTI/Kunitz inhibitor 2      1671   1721
domain   BPTI/Kunitz inhibitor 3      1730   1780
domain   BPTI/Kunitz inhibitor 4      1790   1840
domain   BPTI/Kunitz inhibitor 5      1849   1899
domain   BPTI/Kunitz inhibitor 6      1922   1972
domain   BPTI/Kunitz inhibitor 7      2001   2051
domain   BPTI/Kunitz inhibitor 8      2071   2121
domain   BPTI/Kunitz inhibitor 9      2128   2178
domain   BPTI/Kunitz inhibitor 10      2194   2244
domain   BPTI/Kunitz inhibitor 11      2253   2303
domain   BPTI/Kunitz inhibitor 12      2318   2371
domain   WAP      2452   2498
domain   Ig-like C2-type 1      2523   2607
domain   Ig-like C2-type 2      2617   2697
domain   Ig-like C2-type 3      2749   2840
domain   PLAC      2847   2886
glycosylation site   N-linked (GlcNAc...)   potential   258   258
glycosylation site   N-linked (GlcNAc...)   potential   319   319
glycosylation site   N-linked (GlcNAc...)   potential   419   419
glycosylation site   N-linked (GlcNAc...)      669   669
glycosylation site   N-linked (GlcNAc...)   potential   889   889
glycosylation site   N-linked (GlcNAc...)   potential   914   914
glycosylation site   N-linked (GlcNAc...)   potential   917   917
glycosylation site   N-linked (GlcNAc...)   potential   950   950
glycosylation site   N-linked (GlcNAc...)   potential   1064   1064
glycosylation site   N-linked (GlcNAc...)   potential   1489   1489
glycosylation site   N-linked (GlcNAc...)   potential   1623   1623
glycosylation site   N-linked (GlcNAc...)   potential   1750   1750
glycosylation site   N-linked (GlcNAc...)   potential   2020   2020
glycosylation site   N-linked (GlcNAc...)   potential   2083   2083
glycosylation site   N-linked (GlcNAc...)   potential   2205   2205
glycosylation site   N-linked (GlcNAc...)   potential   2465   2465
glycosylation site   N-linked (GlcNAc...)   potential   2552   2552
glycosylation site   N-linked (GlcNAc...)   potential   2625   2625
glycosylation site   N-linked (GlcNAc...)   potential   2784   2784
glycosylation site   N-linked (GlcNAc...)   potential   2838   2838
splice variant   (in isoform 2, isoform 3)      0   0
splice variant   (in isoform 3, isoform 4)      0   0
splice variant   (in isoform 5)      1789   2373
splice variant   (in isoform 5)      2611   2749
compositionally biased region   Ser-rich      776   1232
compositionally biased region   Cys-rich      1403   1586
SP Length   26
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MDLSRRLCSTALVAFIVLASIHDSQS
Sequence MDLSRRLCSTALVAFIVLASIHDSQSRFPGLRQKRQYGANMYLPESSVTP
GGEGND
PDEWTPWSSPSDCSRTCGGGVSYQTRECLRRDDRGEAVCSGGSR
RYFSCNTQDCP
EEESDFRAQQCSRFDRQQFDGVFYEWVPYTNAPNPCELN
CMPKGERFYYRQREKVVDGTRCNDKDLDVCVNGECMPVGCDMMLGSDAKE
DKCRKCGGDGSTCKTIRNTITTKDLAPGYNDLLLLPEGATNIRIEETVPS
SNYLACR
NHSGHYYLNGDWRIDFPRPMFFANSWWNYQRKPMGFAAPDQLT
CSGPISESLFIVMLVQEK
NISLDYEYSIPESLSHSQQDTHTWTHHQFNAC
SASCGGGSQSRKVTCNNRITLAEVNPSLCDQKSKPVEEQACGTEPCA
PHW
VEGEWSKCSKGCGSDGFQ
NRSITCERISSSGEHTVEEDAVCLKEVGNKPA
TKQECNRDVK
NCPKYHLGPWTPCDKLCGDGKQTRKVTCFIEENGHKRVLP
EEDCVEEKPETEKSCLLTPCE
GVDWIISQWSGCNACGQNTETRTAICGNK
EGKVYPEEFCEPEVPTLSRPCKSPK
CEAQWFSSEWSKCSAPCGKGVKSRI
VICGEFDGKTVTPADDDSKCNKETKPESEQDCE
GEEKVCPGEWFTGPWGK
CSKPCGGGERVREVLCLS
NGTKSVNCDEEKVEPLSEKCNSEACTEDEILP
LTSTDKPIEDDEEDCDEDGIELISDGLSDDEKSEDVIDLEGTAKTETTPE
AEDLMQSDSPTPYDEFESTGTTFEG
SGYDSESTTDSGISTEGSGDDEETS
EASTDLSSSTDSGSTSSDSTSSDSSSSISSDATSEAPASSVSDSSDSTDA
STETTGVSDDSTDVSSSTEASASESTDVSGASDSTGSTNASDSTPESSTE
ASSSTDDSTDSSDNSSNVSESSTEASSSSVSDSNDSSDGSTDGVSSTTEN
SSDSTSDATSDSTASSDSTDSTSDQTTETTPESSTDSTESSTLDASSTTD
ASSTSESSSESSTDGSSTTSNSASSETTGLSSDGSTTDATTAASDNTDIT
TDGSTDESTDGSSNASTEGSTEGASEDTTISTESSGSTESTDAIASDGST
TEGSTVEDLSSSTSSDVTSDSTITDSSPSTEVSGSTDSSSSTDGSSTDAS
STEASSTDVTESTDSTVSGGTSDTTESGPTEESTTEGSTESTTEGSTDST
QSTDLDSTTSDIWSTSDKDDESESSTPYSFDS
EVTKSKPRKCKPKKSTCA
KSEYGCCPDGKSTPKGPFDEGCPIAKTCADTKYGCCLDGVSPAKGKNNKG
CPKSQCAETLFGCCPDKFTAADGENDEGCPETTTVPPTTTTEETQPETTT
EIEGSGQDSTTSEPDTKKSCSFSEFGCCPDAETSAKGPDFEGCGLASPVA
KG
CAESENGCCPDGQTPASGPNGEGCSGCTRERFGCCPDSQTPAHGPNKE
GCCLDTQFGCCPDNILAARGPNNEGCECHYTPYGCCPDNKSAATGYNQEG
CACETTQYGCCPDKITAAKGPKHEGCPCETTQFGCCPDGLTFAKGPHHHG
CHCTQTEFKCCDDEKTPAKGPNGDGCTCVESKFGCC
PDGVTKATDEKFGG
CENVQEPPQKA
CGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDN
RFESEAECKDTC
QDYTGKHVCLLPKSAGPCTGFTKKWYFDVDRNRCEEFQ
YGGCYGTNNRFDSLEQCQGTC
AASENLPTCEQPVESGPCAGNFERWYYDN
ETDICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLKDRCALPKQTGDCS
EKLAKWHFSESEKRCVPFYYSGCGGNKNNFPTLESCEDHCPRQVAKDICE
IPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCD
RKPEPTTTTPATRPQPSRQDVCDEEPAPGECSTWVLKWHFDRKIGACRQF
YYGNCGGNGNRFETENDCQQRCLSQEPPAPTPPRAPAPTRQPDPAPTVAQ
CSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSAR
CSVNIDIRIGADPVEHDTSKCFLAFEPGNCYNNVTRWFYNSAEGLCDEFV
YTGCGGNANNYATEEECQNECNDAQTTCALPPVRGRCSDLSRRWYFDERS
GECHEFEFTGCRGNRNNFVSQSDCLNFCIGEPVVEPSAPTYSVCAEPPEA
GECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFETRDQCERQCGEFKGV
DVCNEPVTTGPCTDWQTKYYFNTASQACEPFTYGGCDGTGNRFSDLFECQ
TVCLAGREPRVGSAKEICLLPVATGRCNGPSVHERRWYYDDEAGNCVSFI
YAGCSGNQNNFRSFEACTNQCRP
EPNKQDNEIGQNPCDTFDAECQELRCP
YGVRRVAARSQPECTQCICENPCEGYSCPEGQQCAIDVASSDDRQFAPVC
R
DIYKPGECPALSANASGCARECYTDADCRGDNKCCSDGCGQLCVHPARP
TQPPRTQAPVVSYPGDARAALE
PKEAHELDVQTAIGGIAVLRCFATGNPA
P
NITWSLKNLVINTNKGRYVLTANGDLTIVQVRQTDDGTYVCVASNGLGE
PVRREVA
LQVTEPVSQPAYIYGDKNVTQIVELNRPAVIRCPAGGFPEPHV
SWWRNGQMFGLKNNLMARDYSLVFNSIQLSDLGLYTCEVYNQRRPVSLRV
TLKAVGPVRPLSPEEEQYMQYVLNPATRPVTQRPSYPYRPTRPAYVPEP
T
VNVHAVLALEPKNSYTPGSTIVMSCSVQGYPEP
NVTWIKDDVPLYNNERV
QITYQPHRLVLSDVTSADSGKYTCRASNAYTYANGEA
NVSIQSVVPVSPE
CVDNPYFANCKLIVKGRYCSNPYYTQFCCRSCTLAG
QVASPPLHPNAV
Original MDLSRRLCSTALVAFIVLASIHDSQSRFPGLRQKRQYGANMYLPESSVTP
GGEGNDPDEWTPWSSPSDCSRTCGGGVSYQTRECLRRDDRGEAVCSGGSR
RYFSCNTQDCPEEESDFRAQQCSRFDRQQFDGVFYEWVPYTNAPNPCELN
CMPKGERFYYRQREKVVDGTRCNDKDLDVCVNGECMPVGCDMMLGSDAKE
DKCRKCGGDGSTCKTIRNTITTKDLAPGYNDLLLLPEGATNIRIEETVPS
SNYLACRNHSGHYYLNGDWRIDFPRPMFFANSWWNYQRKPMGFAAPDQLT
CSGPISESLFIVMLVQEKNISLDYEYSIPESLSHSQQDTHTWTHHQFNAC
SASCGGGSQSRKVTCNNRITLAEVNPSLCDQKSKPVEEQACGTEPCAPHW
VEGEWSKCSKGCGSDGFQNRSITCERISSSGEHTVEEDAVCLKEVGNKPA
TKQECNRDVKNCPKYHLGPWTPCDKLCGDGKQTRKVTCFIEENGHKRVLP
EEDCVEEKPETEKSCLLTPCEGVDWIISQWSGCNACGQNTETRTAICGNK
EGKVYPEEFCEPEVPTLSRPCKSPKCEAQWFSSEWSKCSAPCGKGVKSRI
VICGEFDGKTVTPADDDSKCNKETKPESEQDCEGEEKVCPGEWFTGPWGK
CSKPCGGGERVREVLCLSNGTKSVNCDEEKVEPLSEKCNSEACTEDEILP
LTSTDKPIEDDEEDCDEDGIELISDGLSDDEKSEDVIDLEGTAKTETTPE
AEDLMQSDSPTPYDEFESTGTTFEGSGYDSESTTDSGISTEGSGDDEETS
EASTDLSSSTDSGSTSSDSTSSDSSSSISSDATSEAPASSVSDSSDSTDA
STETTGVSDDSTDVSSSTEASASESTDVSGASDSTGSTNASDSTPESSTE
ASSSTDDSTDSSDNSSNVSESSTEASSSSVSDSNDSSDGSTDGVSSTTEN
SSDSTSDATSDSTASSDSTDSTSDQTTETTPESSTDSTESSTLDASSTTD
ASSTSESSSESSTDGSSTTSNSASSETTGLSSDGSTTDATTAASDNTDIT
TDGSTDESTDGSSNASTEGSTEGASEDTTISTESSGSTESTDAIASDGST
TEGSTVEDLSSSTSSDVTSDSTITDSSPSTEVSGSTDSSSSTDGSSTDAS
STEASSTDVTESTDSTVSGGTSDTTESGPTEESTTEGSTESTTEGSTDST
QSTDLDSTTSDIWSTSDKDDESESSTPYSFDSEVTKSKPRKCKPKKSTCA
KSEYGCCPDGKSTPKGPFDEGCPIAKTCADTKYGCCLDGVSPAKGKNNKG
CPKSQCAETLFGCCPDKFTAADGENDEGCPETTTVPPTTTTEETQPETTT
EIEGSGQDSTTSEPDTKKSCSFSEFGCCPDAETSAKGPDFEGCGLASPVA
KGCAESENGCCPDGQTPASGPNGEGCSGCTRERFGCCPDSQTPAHGPNKE
GCCLDTQFGCCPDNILAARGPNNEGCECHYTPYGCCPDNKSAATGYNQEG
CACETTQYGCCPDKITAAKGPKHEGCPCETTQFGCCPDGLTFAKGPHHHG
CHCTQTEFKCCDDEKTPAKGPNGDGCTCVESKFGCCPDGVTKATDEKFGG
CENVQEPPQKACGLPKETGTCNNYSVKYYFDTSYGGCARFWYGGCDGNDN
RFESEAECKDTCQDYTGKHVCLLPKSAGPCTGFTKKWYFDVDRNRCEEFQ
YGGCYGTNNRFDSLEQCQGTCAASENLPTCEQPVESGPCAGNFERWYYDN
ETDICRPFTYGGCKGNKNNYPTEHACNYNCRQPGVLKDRCALPKQTGDCS
EKLAKWHFSESEKRCVPFYYSGCGGNKNNFPTLESCEDHCPRQVAKDICE
IPAEVGECANYVTSWYYDTQDQACRQFYYGGCGGNENRFPTEESCLARCD
RKPEPTTTTPATRPQPSRQDVCDEEPAPGECSTWVLKWHFDRKIGACRQF
YYGNCGGNGNRFETENDCQQRCLSQEPPAPTPPRAPAPTRQPDPAPTVAQ
CSQPADPGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSAR
CSVNIDIRIGADPVEHDTSKCFLAFEPGNCYNNVTRWFYNSAEGLCDEFV
YTGCGGNANNYATEEECQNECNDAQTTCALPPVRGRCSDLSRRWYFDERS
GECHEFEFTGCRGNRNNFVSQSDCLNFCIGEPVVEPSAPTYSVCAEPPEA
GECDNRTTAWFYDSENMACTAFTYTGCGGNGNRFETRDQCERQCGEFKGV
DVCNEPVTTGPCTDWQTKYYFNTASQACEPFTYGGCDGTGNRFSDLFECQ
TVCLAGREPRVGSAKEICLLPVATGRCNGPSVHERRWYYDDEAGNCVSFI
YAGCSGNQNNFRSFEACTNQCRPEPNKQDNEIGQNPCDTFDAECQELRCP
YGVRRVAARSQPECTQCICENPCEGYSCPEGQQCAIDVASSDDRQFAPVC
RDIYKPGECPALSANASGCARECYTDADCRGDNKCCSDGCGQLCVHPARP
TQPPRTQAPVVSYPGDARAALEPKEAHELDVQTAIGGIAVLRCFATGNPA
PNITWSLKNLVINTNKGRYVLTANGDLTIVQVRQTDDGTYVCVASNGLGE
PVRREVALQVTEPVSQPAYIYGDKNVTQIVELNRPAVIRCPAGGFPEPHV
SWWRNGQMFGLKNNLMARDYSLVFNSIQLSDLGLYTCEVYNQRRPVSLRV
TLKAVGPVRPLSPEEEQYMQYVLNPATRPVTQRPSYPYRPTRPAYVPEPT
VNVHAVLALEPKNSYTPGSTIVMSCSVQGYPEPNVTWIKDDVPLYNNERV
QITYQPHRLVLSDVTSADSGKYTCRASNAYTYANGEANVSIQSVVPVSPE
CVDNPYFANCKLIVKGRYCSNPYYTQFCCRSCTLAGQVASPPLHPNAV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11