Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   766
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P54631    (Created: 1996-10-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   SCW_DROME
Protein Name   Protein screw
Gene   scw
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   400
Protein Mass [Da]   45891
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   16
chain   Protein screw      278   400
disulfide bond      by similarity   300   365
disulfide bond      by similarity   329   397
disulfide bond      by similarity   333   399
disulfide bond   Interchain   by similarity   364   364
glycosylation site   N-linked (GlcNAc...)   potential   165   165
glycosylation site   N-linked (GlcNAc...)   potential   189   189
glycosylation site   N-linked (GlcNAc...)   potential   201   201
glycosylation site   N-linked (GlcNAc...)   potential   304   304
glycosylation site   N-linked (GlcNAc...)   potential   342   342
propeptide      potential   17   277
compositionally biased region   Pro-rich      283   297
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLNVFFLTSLFYAASA
Sequence MLNVFFLTSLFYAASATTYVTTNNHIEMPIYQKRPLSEQMEMIDILDLGD
RPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILIS
NEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAM
LRIYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEF
NLTDTLRYWLHNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPF
IVGYFNGPELLVKIQKLRFKRDLEKRR
AGGGSPPPPPPPPVDLYRPPQSC
ERL
NFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQ
TLMHLKQPHLPKP
CCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGCH
Original MLNVFFLTSLFYAASATTYVTTNNHIEMPIYQKRPLSEQMEMIDILDLGD
RPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILIS
NEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAM
LRIYKQPSLVDRRANFTVSVYRKLDNRQDFSYRILGSVNTTSSQRGWLEF
NLTDTLRYWLHNKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPF
IVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSC
ERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQ
TLMHLKQPHLPKPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGCH
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11