Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   783
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P13728    (Created: 1990-01-01 Updated: 2008-07-22)
UniProtKB/Swiss-Prot Entry Name   SGS3_DROYA
Protein Name   Salivary glue protein Sgs-3
Gene   Sgs3
Organism Scientific   Drosophila yakuba
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   263
Protein Mass [Da]   28392
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   23
chain   Salivary glue protein Sgs-3      24   263
SP Length   23
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKLTIAISLASILLLSVAHVAQG
Sequence MKLTIAISLASILLLSVAHVAQGCDCGCPTTSPKPCQTTVPTCAPTTTTT
TTTTCAPPTRPPPPPCTDAPTTTKRTTEKSTTRRTTTTTRQTTTRPTTTT
TTTTTTRRPTTRSTTTRHTTTTTTTTRRPTTTTTTTRRPTTTTTTTRRPT
TTTTTTRLPTTRSTTTRHTTKSTTSKRPTHETTTTSKRPTQETTTTTRRA
TQATTTPKPTNKPGCGCKSCGPGGIPCGSCPKRQGLCTELNNLLRQLERR
VRECVCGQPVWLL
Original MKLTIAISLASILLLSVAHVAQGCDCGCPTTSPKPCQTTVPTCAPTTTTT
TTTTCAPPTRPPPPPCTDAPTTTKRTTEKSTTRRTTTTTRQTTTRPTTTT
TTTTTTRRPTTRSTTTRHTTTTTTTTRRPTTTTTTTRRPTTTTTTTRRPT
TTTTTTRLPTTRSTTTRHTTKSTTSKRPTHETTTTSKRPTQETTTTTRRA
TQATTTPKPTNKPGCGCKSCGPGGIPCGSCPKRQGLCTELNNLLRQLERR
VRECVCGQPVWLL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11