Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   858
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8IN44    (Created: 2008-11-25 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   TOTA_DROME
Protein Name   Protein Turandot A
Gene   TotA
Organism Scientific   Drosophila melanogaster
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   129
Protein Mass [Da]   14220
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
chain   Protein Turandot A      22   129
glycosylation site   N-linked (GlcNAc...)   potential   49   49
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNSSTALMCFALLLISPLCMG
Sequence MNSSTALMCFALLLISPLCMGYSDEDREADNLRIAEIIKNAQDDDSKINS
TQELLDIYRRLYPSLTPEERESIDKFVNEHTDAIIIDGVPIQGGRKARIV
GKIVSPGVKGLATGFFEELGSKLAQLFTG
Original MNSSTALMCFALLLISPLCMGYSDEDREADNLRIAEIIKNAQDDDSKINS
TQELLDIYRRLYPSLTPEERESIDKFVNEHTDAIIIDGVPIQGGRKARIV
GKIVSPGVKGLATGFFEELGSKLAQLFTG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11