Signal Peptide Database - Drosophila melanogaster

 Entry Details
ID   859
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   B4IUQ9    (Created: 2008-11-25 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   TOTX_DROYA
Protein Name   Protein Turandot X
Gene   TotX
Organism Scientific   Drosophila yakuba
Organism Common   Fruit fly
Lineage   Eukaryota
  Metazoa
    Arthropoda
      Hexapoda
        Insecta
          Pterygota
            Neoptera
              Endopterygota
                Diptera
                  Brachycera
                    Muscomorpha
                      Ephydroidea
                        Drosophilidae
                          Drosophila
                            Sophophora
Protein Length [aa]   150
Protein Mass [Da]   17252
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   22
chain   Protein Turandot X      23   150
SP Length   22
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MQFYITSLLICVLLGIVRFASA
Sequence MQFYITSLLICVLLGIVRFASAGTYSSSYEAHRNYLLNIFHNPLVNDSIK
ERNIPELIAFYHRYPTDVPLSDADRQQFERFIHDYREYRRVLIDGVPPQG
GTIGNVFGHFLGRVGTRYISSLFNKKREEGLSTHAKNSTTPPSRIQNITN
Original MQFYITSLLICVLLGIVRFASAGTYSSSYEAHRNYLLNIFHNPLVNDSIK
ERNIPELIAFYHRYPTDVPLSDADRQQFERFIHDYREYRRVLIDGVPPQG
GTIGNVFGHFLGRVGTRYISSLFNKKREEGLSTHAKNSTTPPSRIQNITN
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11