Signal Peptide Database - Drosophila melanogaster

    

<< < 455 - 504 (of 654)> >>
Accession NumberEntry NameProtein NameOrganismLengthSP StatusSignal Sequence
Q9VQ62 NPC2_DROME Protein NPC2 homolog Drosophila melanogaster 16 potential MLRYAVIACAALVVFA
Q9V4X2 PGSC2_DROME Peptidoglycan-recognition protein-SC2 Drosophila melanogaster 20 potential MANKALILLAVLFCAQAVLG
Q24488 ROR1_DROME Tyrosine-protein kinase transmembrane receptor Ror Drosophila melanogaster 24 potential MNKYSAFIVCISLVLLFTKKDVGS
Q00725 SGS4_DROME Salivary glue protein Sgs-4 Drosophila melanogaster 21 potential MRLELLVVLLVGLAALAPSGS
Q9VIQ0 SNPF_DROME Short neuropeptide F Drosophila melanogaster 30 potential MFHLKRELSQGCALALICLVSLQMQQPAQA
P18475 TOR_DROME Tyrosine-protein kinase receptor torso Drosophila melanogaster 20 potential MLIFYAKYAFIFWFFVGSNQ
Q9VDH4 TOTB_DROME Protein Turandot B Drosophila melanogaster 21 potential MNFKTSLICFALLLIGTLCSA
B4R1Q1 TOTZ_DROSI Protein Turandot Z Drosophila simulans 23 potential MYFAIRLSFVLAVLFCLTGNGSA
Q24155 TRUNK_DROME Protein trunk Drosophila melanogaster 19 potential MKSQSELAIVLTWLAVLGT
P54628 TRYT_DROER Trypsin theta Drosophila erecta 19 probable MHGLVVLLVCLAVGSAFAG
Q8IRR1 VNNL2_DROME Vanin-like protein 2 Drosophila melanogaster 27 potential MAKNYWGFFLFCLALGLMLNLSQQASL
P28465 WNT2_DROME Protein Wnt-2 Drosophila melanogaster 23 potential MWKIHNKLLIYILWIMEIRLVSS
P09957 YELL_DROME Protein yellow Drosophila melanogaster 21 potential MFQDKGWILVTLITLVTPSWA
Q9VVW1 A76A_DROME Accessory gland protein Acp76A Drosophila melanogaster 22 potential MGNHQVIFLVLCTSLLFQNTIQ
P07140 ACES_DROME Acetylcholinesterase Drosophila melanogaster 38 confirmed MAISCRQSRVLPMSLPLPLTIPLPLVLVLS...
P83833 AMYA_DROYA Alpha-amylase A Drosophila yakuba 18 by similarity MFLAKSIVCLALLAVANA
O76284 AMYR_DROBC Alpha-amylase-related protein Drosophila bocqueti 20 by similarity MIKFALALTLCLAGASLSLA
Q24738 BOSS_DROVI Protein bride of sevenless Drosophila virilis 30 potential MSGLQLIWKSPTQLVLFVLLITISCIDLCH
Q24298 CADE_DROME DE-cadherin Drosophila melanogaster 69 potential MSTSVQRMSRSYHCINMSATPQAGHLNPAQ...
P27780 CUP8_DROME Pupal cuticle protein Edg-84A Drosophila melanogaster 17 potential MLVKTALFVTLIGLAQA
Q9VWE0 DOME_DROME Cytokine receptor Drosophila melanogaster 23 potential MVAQEQLVLLLMLLAGCRGGANA
Q05487 ESTS_DROVI Esterase S Drosophila virilis 22 by similarity MTQILLPIALLCLFAASTLSNP
Q07407 FGFR1_DROME Fibroblast growth factor receptor homolog 1 Drosophila melanogaster 36 potential MAAAWSWRASHSTITMTSGSVVVLFLLLTI...
Q9VVX3 FRIZ2_DROME Frizzled-2 Drosophila melanogaster 22 potential MRHNRLKVLILGLVLLLTSCRA
P25123 GBRB_DROME Gamma-aminobutyric acid receptor subunit beta Drosophila melanogaster 44 potential MSDSKMDKLARMAPLPRTPLLTIWLAINMA...
P82701 IM18_DROME Immune-induced peptide 18 Drosophila melanogaster 24 potential MKLIALCCLLLLGLLGFLAAPGVA
P12080 ITA2_DROME Integrin alpha-PS2 Drosophila melanogaster 31 potential MSGDSIHRRRMALHCPITSLILLLIAMSAH...
P07187 LCP2_DROME Larval cuticle protein 2 Drosophila melanogaster 16 confirmed MFKFVMILAVVGVATA
Q8SYV9 MTH14_DROME Probable G-protein coupled receptor Mth-like 14 Drosophila melanogaster 23 potential MNLGHWNFLLALISLQTFFNASA
P61849 NEMS_DROME Dromyosuppressin Drosophila melanogaster 24 potential MSFAQFFVACCLAIVLLAVSNTRA
Q27377 OB10_DROME Putative odorant-binding protein A10 Drosophila melanogaster 29 potential MGQPGFRRAIGHVSLVVALMCTTCFQVEG
Q9W3C7 PPT1_DROME Palmitoyl-protein thioesterase 1 Drosophila melanogaster 25 potential MISICCSRFSCILFLLFLIFSLVLS
Q9V6K3 ROR2_DROME Tyrosine-protein kinase transmembrane receptor Ror2 Drosophila melanogaster 41 potential MAAGQWVGVVERVLRGMVLKWGANLAVLGL...
P02842 SGS8_DROME Salivary glue protein Sgs-8 Drosophila melanogaster 24 confirmed MKLLVVAVIACIMLIGFADPASGC
P24014 SLIT_DROME Protein slit Drosophila melanogaster 36 confirmed MAAPSRTTLMPPPFRLQLRLLILPILLLLR...
Q9VH14 TIMP_DROME Tissue inhibitor of metalloproteases Drosophila melanogaster 27 potential MDLRKHLGLLTLLLVAVFAFYGRPADA
P25723 TLD_DROME Dorsal-ventral patterning protein tolloid Drosophila melanogaster 36 potential MKGMRLMPMKMKAKLVVLSVGALWMMMFFL...
B4PPU5 TOTB_DROYA Protein Turandot B Drosophila yakuba 21 potential MNFNMSMICFALLLIVTLCSA
P42276 TRYDG_DROME Trypsin delta/gamma Drosophila melanogaster 22 probable MLKFVILLSAVACALGGTVPEG
P54356 TSG_DROME Protein twisted gastrulation Drosophila melanogaster 23 potential MQLLCYFVILFVGIAPWSSLAND
P02844 VIT2_DROME Vitellogenin-2 Drosophila melanogaster 19 potential MNPLRTLCVMACLLAVAMG
O02437 YELL_DROSU Protein yellow Drosophila subobscura 28 potential MHAQDKGGILPALSLLLIAVAMVSPSQA
O46202 A62F_DROME Accessory gland protein Acp62F Drosophila melanogaster 24 potential MTDMWSLKICACLGLLLLFKPIDS
Q8WSV1 ANDP_DROTE Andropin Drosophila teissieri 22 potential MKYFSVLVVLTLILAIVDQSDA
Q9V496 APLP_DROME Apolipophorins Drosophila melanogaster 25 confirmed MARMKYNIALIGILASVLLTIAVNA
Q9V751 ATTB_DROME Attacin-B Drosophila melanogaster 17 potential MQKTSILILALFAIAEA
Q95029 CATL_DROME Cathepsin L Drosophila melanogaster 48 potential MNHLGVFETRFRPRTRHKSQRAQLIPEQIT...
Q29NC4 CBPA1_DROPS Zinc carboxypeptidase A 1 Drosophila pseudoobscura pseudoobscura 22 potential MSLTKSLLLALLAVVALAGVSA
P84021 CECC_DROSI Cecropin-C Drosophila simulans 23 confirmed MNFYKIFVFVALILAISIGQSEA
Q29CA0 CP2B_DROPS Cardio acceleratory peptide 2b Drosophila pseudoobscura pseudoobscura 26 potential MKAIFSLYNIVSAILLLVLLAEFSTA
<< < 455 - 504 (of 654)> >>

© 2007-2017 Dr. Katja Kapp, Kassel & thpr.net e. K., Dresden, Germany, last update 2010-06-11