Signal Peptide Database - Mammalia

 Entry Details
ID   102
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q1KLY8    (Created: 2006-10-03 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CAMP_ATEFR
Protein Name   Cathelicidin antimicrobial peptide
Gene   CAMP
Organism Scientific   Ateles fusciceps robustus
Organism Common   Colombian black-faced spider monkey
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Platyrrhini
                        Atelidae
                          Atelinae
                            Ateles
Protein Length [aa]   170
Protein Mass [Da]   19002
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   30
chain   Antibacterial protein FALL-39      132   170
chain   Antibacterial protein LL-37      134   170
propeptide      potential   31   131
SP Length   30
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKTQRDGPSLGRWSLVLLLLGLTMPLAVIA
Sequence MKTQRDGPSLGRWSLVLLLLGLTMPLAVIARVLSYQEAVLRAVDVLNQRS
SDANLYRLLNLDPRPTMDGDPDTPKPVSFTVKETVCPRTIQRSPEECDFK
EDGLVKWCVGTVTLNQAKDSFDISCDKDKRK
VAQLGDVLQKAGEKIVRGL
KNIGQRIKDFFGKLTPRTES
Original MKTQRDGPSLGRWSLVLLLLGLTMPLAVIARVLSYQEAVLRAVDVLNQRS
SDANLYRLLNLDPRPTMDGDPDTPKPVSFTVKETVCPRTIQRSPEECDFK
EDGLVKWCVGTVTLNQAKDSFDISCDKDKRKVAQLGDVLQKAGEKIVRGL
KNIGQRIKDFFGKLTPRTES
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11