Signal Peptide Database - Mammalia

 Entry Details
ID   104
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   O97943    (Created: 1999-07-15 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CASA1_CAMDR
Protein Name   Alpha-S1-casein
Gene   CSN1S1
Organism Scientific   Camelus dromedarius
Organism Common   Dromedary
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Laurasiatheria
                  Cetartiodactyla
                    Tylopoda
                      Camelidae
                        Camelus
Protein Length [aa]   230
Protein Mass [Da]   26861
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   15
chain   Alpha-S1-casein      16   230
modified residue   Phosphoserine   probable   33   33
modified residue   Phosphoserine   probable   83   83
modified residue   Phosphoserine   probable   85   85
modified residue   Phosphoserine   probable   86   86
modified residue   Phosphoserine   probable   87   87
modified residue   Phosphoserine   probable   88   88
splice variant   (in isoform Short)      170   177
SP Length   15
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKLLILTCLVAVALA
Sequence MKLLILTCLVAVALARPKYPLRYPEVFQNEPDSIEEVLNKRKILELAVVS
PIQFRQENIDELKDTRNEPTEDHIMEDTERKE
SGSSSSEEVVSSTTEQKD
ILKEDMPSQRYLEELHRLNKYKLLQLEAIRDQKLIPRVKLSSHPYLEQLY
RINEDNHPQLGEPVKVVTQ
EQAYFHLEPFPQFFQLGASPYVAWYYPPQVM
QYIAHPSSYDTPEGIASEDGGKTDVMPQWW
Original MKLLILTCLVAVALARPKYPLRYPEVFQNEPDSIEEVLNKRKILELAVVS
PIQFRQENIDELKDTRNEPTEDHIMEDTERKESGSSSSEEVVSSTTEQKD
ILKEDMPSQRYLEELHRLNKYKLLQLEAIRDQKLIPRVKLSSHPYLEQLY
RINEDNHPQLGEPVKVVTQEQAYFHLEPFPQFFQLGASPYVAWYYPPQVM
QYIAHPSSYDTPEGIASEDGGKTDVMPQWW
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11