Signal Peptide Database - Mammalia

 Entry Details
ID   105
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9XSE4    (Created: 2000-12-01 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   CASB_TRIVU
Protein Name   Beta-casein
Gene   CSN2
Organism Scientific   Trichosurus vulpecula
Organism Common   Brush-tailed possum
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Metatheria
                Diprotodontia
                  Phalangeridae
                    Trichosurus
Protein Length [aa]   285
Protein Mass [Da]   33802
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   15
chain   Beta-casein      16   285
modified residue   Phosphoserine   by similarity   23   23
modified residue   Phosphoserine   by similarity   25   25
modified residue   Phosphoserine   by similarity   62   62
modified residue   Phosphoserine   by similarity   87   87
SP Length   15
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKLLILTCLVVLAVA
Sequence MKLLILTCLVVLAVARPMVEKISESEEHVTDVPENEHRLEINRYLRPEYE
MMNLYYQPFYW
SEEMRNLKMTSLPKDRRMAVLKSVVSDDMLPPLQHKSLS
LPKPKVLPLSHRQILPPHTLRMVPLSHKLFTIPKREMLPISERERLPAHE
RENLLAHEREILLAPQREMSLIPEREILLAAERVVLPEQEREIRPDNERE
VLAVHKREILPASEKEKVLPLFQERVLPLHRREIVPPYQRDTIARREILP
VDQRELMPEVVAVDLYPFFQPVANFYYPAELNEKN
Original MKLLILTCLVVLAVARPMVEKISESEEHVTDVPENEHRLEINRYLRPEYE
MMNLYYQPFYWSEEMRNLKMTSLPKDRRMAVLKSVVSDDMLPPLQHKSLS
LPKPKVLPLSHRQILPPHTLRMVPLSHKLFTIPKREMLPISERERLPAHE
RENLLAHEREILLAPQREMSLIPEREILLAAERVVLPEQEREIRPDNERE
VLAVHKREILPASEKEKVLPLFQERVLPLHRREIVPPYQRDTIARREILP
VDQRELMPEVVAVDLYPFFQPVANFYYPAELNEKN
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11