Signal Peptide Database - Mammalia

 Entry Details
ID   106
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P19442    (Created: 1991-02-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CASK_CAVPO
Protein Name   Kappa-casein
Gene   CSN3
Organism Scientific   Cavia porcellus
Organism Common   Guinea pig
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Hystricognathi
                        Caviidae
                          Cavia
Protein Length [aa]   234
Protein Mass [Da]   25597
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   21
chain   Kappa-casein      22   234
region of interest   3 X 27 AA tandem repeats      127   207
repeat   1      127   153
repeat   2      154   179
repeat   3      180   207
site   Cleavage; by chymosin/rennin      118   119
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MMKSFLLVVNIVALTLPFLAA
Sequence MMKSFLLVVNIVALTLPFLAAEVQNQEQPACCGNDERLFEQKKVLYLLSY
PVLNNYLRTAPSYYQNRASVPINNPYLCHLYYVPSFVLWAQGQIPKGPVS
TDIHQSTMQYHQAKHPS
FMAILSKKILGKATILSTDAIAAPEQTPVSAAQ
PTV
SAGDTPEVSSQFIDTPDTSVLAEEARESPEDTPEISEFINAPDTAVP
SEEPRES
AEDTPEISSEFIFSPETSTGPAIASMA
Original MMKSFLLVVNIVALTLPFLAAEVQNQEQPACCGNDERLFEQKKVLYLLSY
PVLNNYLRTAPSYYQNRASVPINNPYLCHLYYVPSFVLWAQGQIPKGPVS
TDIHQSTMQYHQAKHPSFMAILSKKILGKATILSTDAIAAPEQTPVSAAQ
PTVSAGDTPEVSSQFIDTPDTSVLAEEARESPEDTPEISEFINAPDTAVP
SEEPRESAEDTPEISSEFIFSPETSTGPAIASMA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11