Signal Peptide Database - Mammalia

 Entry Details
ID   107
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q29137    (Created: 1997-11-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   CASK_TRAJA
Protein Name   Kappa-casein
Gene   CSN3
Organism Scientific   Tragulus javanicus
Organism Common   Lesser Malay chevrotain
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Laurasiatheria
                  Cetartiodactyla
                    Ruminantia
                      Tragulina
                        Tragulidae
                          Tragulus
Protein Length [aa]   171
Protein Mass [Da]   19106
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   2
chain   Kappa-casein      3   171
site   Cleavage; by chymosin/rennin   by similarity   107   108
non-terminal residue         1   1
SP Length   2
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide VA
Sequence VAQVQYQEQLTGCENDERFFNDKTIKYIPIPYLLNRYPSYGLNYYQQRPP
ALINNQFLPFSFYAKPMAVRSPAQILQWQVPLNAVSAKPCQAPPTTMARR
PRPHLS
FMAIPPKKDQDKTDTPTINTIVTVEPTTTPTTESIVNTVATLEA
SSESIASAPETTTVQVTSAEV
Original VAQVQYQEQLTGCENDERFFNDKTIKYIPIPYLLNRYPSYGLNYYQQRPP
ALINNQFLPFSFYAKPMAVRSPAQILQWQVPLNAVSAKPCQAPPTTMARR
PRPHLSFMAIPPKKDQDKTDTPTINTIVTVEPTTTPTTESIVNTVATLEA
SSESIASAPETTTVQVTSAEV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11