Signal Peptide Database - Mammalia

 Entry Details
ID   109
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P25796    (Created: 1992-05-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   CATE_CAVPO
Protein Name   Cathepsin E
Gene   CTSE
Organism Scientific   Cavia porcellus
Organism Common   Guinea pig
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Hystricognathi
                        Caviidae
                          Cavia
Protein Length [aa]   391
Protein Mass [Da]   42132
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   19
chain   Cathepsin E      54   391
disulfide bond   Interchain   probable   56   56
disulfide bond      by similarity   105   110
disulfide bond      by similarity   267   271
disulfide bond      by similarity   309   346
glycosylation site   N-linked (GlcNAc...)   potential   86   86
active site      by similarity   92   92
active site      by similarity   276   276
propeptide   Activation peptide   potential   20   53
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKTFLLLLLVLLELGQAPG
Sequence MKTFLLLLLVLLELGQAPGALHRVPLSRRESLRKKLRAQGQLTELWKSQN
LNM
DQCSTIQSANEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWV
PSVY
CTSPACQTHPVFHPSLSSTYREVGNSFSIQYGTGSLTGIIGADQVS
VEGLTVVGQQFGESVQEPGKTFVHAEFDGILGLGYPSLAAGGVTPVFDNM
MAQNLVALPMFSVYMSSNPGGSGSELTFGGYDPSHFSGSLNWVPVTKQAY
WQIALDGIQVGDSVMF
CSEGCQAIVDTGTSLITGPPGKIKQLQEALGATY
VDEGYSVQ
CANLNMMLDVTFIINGVPYTLNPTAYTLLDFVDGMQVCSTGF
EGLEIQPPAGPLWILGDVFIRQFYAVFDRGNNRVGLAPAVP
Original MKTFLLLLLVLLELGQAPGALHRVPLSRRESLRKKLRAQGQLTELWKSQN
LNMDQCSTIQSANEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWV
PSVYCTSPACQTHPVFHPSLSSTYREVGNSFSIQYGTGSLTGIIGADQVS
VEGLTVVGQQFGESVQEPGKTFVHAEFDGILGLGYPSLAAGGVTPVFDNM
MAQNLVALPMFSVYMSSNPGGSGSELTFGGYDPSHFSGSLNWVPVTKQAY
WQIALDGIQVGDSVMFCSEGCQAIVDTGTSLITGPPGKIKQLQEALGATY
VDEGYSVQCANLNMMLDVTFIINGVPYTLNPTAYTLLDFVDGMQVCSTGF
EGLEIQPPAGPLWILGDVFIRQFYAVFDRGNNRVGLAPAVP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11