Signal Peptide Database - Mammalia

 Entry Details
ID   11
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P23795    (Created: 1991-11-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   ACES_BOVIN
Protein Name   Acetylcholinesterase
Gene   ACHE
Organism Scientific   Bos taurus
Organism Common   Bovine
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Laurasiatheria
                  Cetartiodactyla
                    Ruminantia
                      Pecora
                        Bovidae
                          Bovinae
                            Bos
Protein Length [aa]   613
Protein Mass [Da]   67664
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   30
chain   Acetylcholinesterase      31   613
disulfide bond      by similarity   99   126
disulfide bond      by similarity   287   302
disulfide bond      by similarity   439   559
disulfide bond   Interchain   by similarity   610   610
glycosylation site   N-linked (GlcNAc...)   probable   91   91
glycosylation site   N-linked (GlcNAc...)   probable   295   295
glycosylation site   N-linked (GlcNAc...)   probable   380   380
glycosylation site   N-linked (GlcNAc...)   probable   494   494
active site   Acyl-ester intermediate   by similarity   233   233
active site   Charge relay system   by similarity   364   364
active site   Charge relay system   by similarity   477   477
splice variant   (in isoform H)      0   0
SP Length   30
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MRPPWCPLHTPSLTPPLLLLLFLIGGGAEA
Sequence MRPPWCPLHTPSLTPPLLLLLFLIGGGAEAEGPEDPELLVMVRGGRLRGL
RLMAPRGPVSAFLGIPFAEPPVGPRRFLPPEPKRPWPGVL
NATAFQSVCY
QYVDTLYPGFEGTEMWNPNRELSEDC
LYLNVWTPYPRPSSPTPVLVWIYG
GGFYSGASSLDVYDGRFLTQAEGTVLVSMNYRVGAFGFLALPGSREAPGN
VGLLDQRLALQWVQENVAAFGGDPTSVTLFGE
SAGAASVGMHLLSPPSRG
LFHRAVLQSGAPNGPWATVGVGEARRRATLLARLVG
CPPGGAGGNDTELV
AC
LRARPAQDLVDHEWRVLPQESVFRFSFVPVVDGDFLSDTPEALINAGD
FHGLQVLVGVVKD
EGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQA
SDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVV
CPVAQLAGRLAA
QGARVYAYIFEHRASTLSWPLWMGVP
HGYEIEFIFGLPLEPSLNYTIEER
TFAQRLMRYWANFARTGDPNDPRDPKAPQWPPYTAGAQQYVSLNLRPLEV
RRGLRAQAC
AFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQ
FDHYSKQDR
CSDL
Original MRPPWCPLHTPSLTPPLLLLLFLIGGGAEAEGPEDPELLVMVRGGRLRGL
RLMAPRGPVSAFLGIPFAEPPVGPRRFLPPEPKRPWPGVLNATAFQSVCY
QYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPSSPTPVLVWIYG
GGFYSGASSLDVYDGRFLTQAEGTVLVSMNYRVGAFGFLALPGSREAPGN
VGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRG
LFHRAVLQSGAPNGPWATVGVGEARRRATLLARLVGCPPGGAGGNDTELV
ACLRARPAQDLVDHEWRVLPQESVFRFSFVPVVDGDFLSDTPEALINAGD
FHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQA
SDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLAA
QGARVYAYIFEHRASTLSWPLWMGVPHGYEIEFIFGLPLEPSLNYTIEER
TFAQRLMRYWANFARTGDPNDPRDPKAPQWPPYTAGAQQYVSLNLRPLEV
RRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQ
FDHYSKQDRCSDL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11