Signal Peptide Database - Mammalia

 Entry Details
ID   110
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P61276    (Created: 2004-05-10 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   CATK_MACFA
Protein Name   Cathepsin K
Gene   CTSK
Organism Scientific   Macaca fascicularis
Organism Common   Crab eating macaque
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Cercopithecidae
                          Cercopithecinae
                            Macaca
Protein Length [aa]   329
Protein Mass [Da]   36942
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   15
chain   Cathepsin K      115   329
disulfide bond      by similarity   136   177
disulfide bond      by similarity   170   210
disulfide bond      by similarity   269   318
glycosylation site   N-linked (GlcNAc...)   potential   103   103
active site      by similarity   139   139
active site      by similarity   276   276
active site      by similarity   296   296
propeptide   Activation peptide      16   114
SP Length   15
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MWGLKVLLLPVMSFA
Sequence MWGLKVLLLPVMSFALYPEEILDTHWELWKKTHRKQYNSKVDEISRRLIW
EKNLKYISIHNLEASLGVHTYELAMNHLGDMTNEEVVQKMTGLKVPASHS
RSNDTLYIPDWEGR
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEG
QLKKKTGKLLNLSPQNLVD
CVSENDGCGGGYMTNAFQYVQKNRGIDSEDA
YPYVGQEESC
MYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAID
ASLTSFQFYSKGVYYDES
CNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNAC
GIANLASFPKM
Original MWGLKVLLLPVMSFALYPEEILDTHWELWKKTHRKQYNSKVDEISRRLIW
EKNLKYISIHNLEASLGVHTYELAMNHLGDMTNEEVVQKMTGLKVPASHS
RSNDTLYIPDWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEG
QLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDA
YPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAID
ASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11