Signal Peptide Database - Mammalia

 Entry Details
ID   12
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9GLN7    (Created: 2005-08-30 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   ACE_PANTR
Protein Name   Angiotensin-converting enzyme, somatic isoform
Gene   ACE
Organism Scientific   Pan troglodytes
Organism Common   Chimpanzee
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Pan
Protein Length [aa]   1304
Protein Mass [Da]   149370
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   27
chain   Angiotensin-converting enzyme, somatic isoform      28   1304
chain   Angiotensin-converting enzyme, somatic isoform, soluble form      28   1230
transmembrane region      potential   1258   1274
topological domain   Extracellular   potential   28   1257
topological domain   Cytoplasmic   potential   1275   1304
region of interest   Peptidase M2 1      28   628
region of interest   Peptidase M2 2      629   1230
modified residue   Phosphoserine   by similarity   1297   1297
glycosylation site   N-linked (GlcNAc...)   potential   36   36
glycosylation site   N-linked (GlcNAc...)   potential   72   72
glycosylation site   N-linked (GlcNAc...)   potential   109   109
glycosylation site   N-linked (GlcNAc...)   potential   144   144
glycosylation site   N-linked (GlcNAc...)   potential   316   316
glycosylation site   N-linked (GlcNAc...)   potential   440   440
glycosylation site   N-linked (GlcNAc...)   potential   712   712
active site   1   by similarity   389   389
active site   2   by similarity   987   987
propeptide   Removed in secreted form   by similarity   1231   1304
metal ion-binding site   Zinc 1; catalytic   by similarity   388   388
metal ion-binding site   Zinc 1; catalytic   by similarity   392   392
metal ion-binding site   Zinc 2; catalytic   by similarity   986   986
metal ion-binding site   Zinc 2; catalytic   by similarity   990   990
metal ion-binding site   Zinc 2; catalytic   by similarity   1014   1014
binding site   Chloride 1   by similarity   789   789
binding site   Chloride 2   by similarity   827   827
binding site   Chloride 1   by similarity   1088   1088
binding site   Chloride 1   by similarity   1092   1092
binding site   Chloride 2   by similarity   1125   1125
SP Length   27
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MGAASGRRGPGLLLPLLLLLPPQPALA
Sequence MGAASGRRGPGLLLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQS
YNSSAEQVLFQSVAASWAHDT
NITAENARRQEEAALLSQEFAEAWGQKAK
ELYEPVWQ
NFTDPQLRRIIGAVRTLGSANLPLAKRQQYNALLSNMSRIYS
TAKVCLPNKTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKP
LYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQLEPLYL
NLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPFPD
KPNLDVTSTMLQQGW
NATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPA
DGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVH
HEMGHIQYYLQYK
DLPVSLRGGANPGFHEAIGDVLALSVSTPAHLHKIGLLD
NVTNDTESDIN
YLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPNSRYNFDWWYLRTKYQGI
CPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEAGYEG
PLHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLLKY
FQPVTQWLQEQNQQNGEVLGWPEYQWHP
PLPDNYPEGIDLVTDEAEASKF
VEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGT
QARRFDVNQLQ
NTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYS
VATVCHTNGSCLQLEPDLTNVMATSRKYEDLLWAWEGW
RDKAGRAILQFY
PKYVELINQAARLNGYVDAGDSWRSM
YETPSLEQDLERLFQELQPLYLNL
HAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAP
SMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDG
REVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAH
HEMGHIQYFMQYKDL
PVALREGANPGFH
EAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFL
MKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQE
WWSLRLKYQGLCP
PVPRTQGDFDPGAKFHIPSSVPYI
RYFVSFIIQFQFHEALCQAAGHTGPL
HKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFK
PLLDWLRTENELHGEKLGWPQYNWTPNSAR
SEGPLPDSGRVSFLGLDLDA
QQARVGQWLLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFDSEVE
LRHS
Original MGAASGRRGPGLLLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQS
YNSSAEQVLFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAK
ELYEPVWQNFTDPQLRRIIGAVRTLGSANLPLAKRQQYNALLSNMSRIYS
TAKVCLPNKTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKP
LYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQLEPLYL
NLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPFPD
KPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPA
DGREVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYK
DLPVSLRGGANPGFHEAIGDVLALSVSTPAHLHKIGLLDNVTNDTESDIN
YLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPNSRYNFDWWYLRTKYQGI
CPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHEALCKEAGYEG
PLHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLLKY
FQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKF
VEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGT
QARRFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYS
VATVCHTNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFY
PKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNL
HAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAP
SMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDG
REVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDL
PVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFL
MKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCP
PVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPL
HKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFK
PLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDA
QQARVGQWLLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFDSEVE
LRHS
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11