Signal Peptide Database - Mammalia

 Entry Details
ID   14
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8SPU7    (Created: 2006-06-27 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ACHA5_BOVIN
Protein Name   Neuronal acetylcholine receptor subunit alpha-5
Gene   CHRNA5
Organism Scientific   Bos taurus
Organism Common   Bovine
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Laurasiatheria
                  Cetartiodactyla
                    Ruminantia
                      Pecora
                        Bovidae
                          Bovinae
                            Bos
Protein Length [aa]   475
Protein Mass [Da]   54260
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   29
chain   Neuronal acetylcholine receptor subunit alpha-5      30   475
disulfide bond      by similarity   177   191
disulfide bond   Associated with receptor activation   by similarity   241   242
transmembrane region      potential   262   282
transmembrane region      potential   289   309
transmembrane region      potential   324   344
transmembrane region      potential   438   458
topological domain   Extracellular   by similarity   30   261
topological domain   Cytoplasmic   by similarity   345   437
topological domain   Extracellular   by similarity   459   475
glycosylation site   N-linked (GlcNAc...)   potential   190   190
glycosylation site   N-linked (GlcNAc...)   potential   236   236
SP Length   29
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MAAPGWGRWVLGLGPLLLQVFLPFQLVAG
Sequence MAAPGWGRWVLGLGPLLLQVFLPFQLVAGRWGPEGAGGGVRRGLAEPSVV
AKHEDSLFKDLFQDYERWVRPVEHLNDRIKIKFGLAISQLVDVDEKNQLM
TTNVWLKQEWIDVKLRWNPDDYGGIKLIRVPSDSLWTPDIVLFDNADGRF
EGASTKTVVRYDGTVTWTPPANYKSSCTIDVTFFPFDLQ
NCSMKFGSWTY
DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKG
NRTDSCCWYPYITYS
FVIKRLPLFYT
LFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLT
VFLLVIEEI
IPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSS
THDAMAPWVRKIFLHKLPKLLCMRSHVDRYFSQKEEARSSRGPRSSRNAL
EAALDSVRYITRHVMKETDVREVVEDWKFIAQVLDRM
FLWTFLLVSVVGS
LGLFVPVI
YKWANIIVPIHIGNENK
Original MAAPGWGRWVLGLGPLLLQVFLPFQLVAGRWGPEGAGGGVRRGLAEPSVV
AKHEDSLFKDLFQDYERWVRPVEHLNDRIKIKFGLAISQLVDVDEKNQLM
TTNVWLKQEWIDVKLRWNPDDYGGIKLIRVPSDSLWTPDIVLFDNADGRF
EGASTKTVVRYDGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTY
DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYITYS
FVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLT
VFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSS
THDAMAPWVRKIFLHKLPKLLCMRSHVDRYFSQKEEARSSRGPRSSRNAL
EAALDSVRYITRHVMKETDVREVVEDWKFIAQVLDRMFLWTFLLVSVVGS
LGLFVPVIYKWANIIVPIHIGNENK
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11