Signal Peptide Database - Mammalia

 Entry Details
ID   15
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P02708    (Created: 1986-07-21 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   ACHA_HUMAN
Protein Name   Acetylcholine receptor subunit alpha
Gene   CHRNA1
Organism Scientific   Homo sapiens
Organism Common   Human
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Homo
Protein Length [aa]   482
Protein Mass [Da]   54546
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   20
chain   Acetylcholine receptor subunit alpha      21   482
disulfide bond         173   187
disulfide bond   Associated with receptor activation      237   238
transmembrane region         256   280
transmembrane region         288   306
transmembrane region         322   341
transmembrane region         454   472
topological domain   Extracellular      21   255
topological domain   Cytoplasmic      342   453
glycosylation site   N-linked (GlcNAc...)   potential   186   186
sequence variant   (in dbSNP:rs6739001)      0   0
sequence variant   (in FCCMS; abnormally slow channel opening, closing resulting in abnormally brief current)      0   0
sequence variant   (in SCCMS)      0   0
sequence variant   (in FCCMS; fewer, shorter ion channel activations with decreased channel opening rate, increased channel closing rate)      0   0
sequence variant   (in SCCMS)      0   0
sequence variant   (in SCCMS; causes increased channel opening in absence of ACh; prolonged opening in presence of ACh; increased affinity for ACh, enhanced desensitization)      0   0
sequence variant   (in FCCMS; markedly reduced protein expression)      0   0
sequence variant   (in SCCMS)      0   0
sequence variant   (in lethal type multiple pterygium syndrome)      0   0
sequence variant   (in SCCMS)      0   0
sequence variant   (in SCCMS)      0   0
sequence variant   (in FCCMS; mutant channel shows an approximately 30-fold decrease of ACh binding affinity for the second of 2 closed-state binding sites but only a 2- fold decrease in gating efficiency)      0   0
sequence variant   (in SCCMS; increases the rate of channel opening, slows the rate of channel closing but has no effect on agonist binding)      0   0
splice variant   (in isoform 1)      79   103
SP Length   20
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MEPWPLLLLFSLCSAGLVLG
Sequence MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVE
VTVGLQLIQLINVDEVNQIVTTNVRLKQ
GDMVDLPRPSCVTLGVPLFSHL
QNE
QWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKF
TKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQ
NCSMKLGTWTYDGSV
VAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHF
VMQRL
PLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIV
ELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPST
HVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKP
GPPPMGFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWKYVAMV
MDH
ILLGVFMLVCIIGTLAVFAGRLIELNQQG
Original MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVE
VTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHL
QNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKF
TKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSV
VAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHF
VMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTV
FLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPST
HVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKP
GPPPMGFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWKYVAMV
MDHILLGVFMLVCIIGTLAVFAGRLIELNQQG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11