Signal Peptide Database - Mammalia

 Entry Details
ID   20
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8K410    (Created: 2004-12-07 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ADA32_MOUSE
Protein Name   ADAM 32
Gene   Adam32
Organism Scientific   Mus musculus
Organism Common   Mouse
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Mus
Protein Length [aa]   750
Protein Mass [Da]   83612
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   18
chain   ADAM 32      173   750
disulfide bond      by similarity   292   375
disulfide bond      by similarity   334   359
disulfide bond      by similarity   336   341
disulfide bond      by similarity   450   471
disulfide bond      by similarity   628   638
disulfide bond      by similarity   632   644
disulfide bond      by similarity   646   655
transmembrane region      potential   686   706
topological domain   Extracellular   potential   173   685
topological domain   Cytoplasmic   potential   707   750
domain   Peptidase M12B      183   380
domain   Disintegrin      387   479
domain   EGF-like      624   656
modified residue   Phosphoserine   by similarity   19   19
glycosylation site   N-linked (GlcNAc...)   potential   122   122
glycosylation site   N-linked (GlcNAc...)   potential   358   358
glycosylation site   N-linked (GlcNAc...)   potential   465   465
glycosylation site   N-linked (GlcNAc...)   potential   566   566
glycosylation site   N-linked (GlcNAc...)   potential   567   567
splice variant   (in isoform 2)      0   0
splice variant   (in isoform 2)      0   0
propeptide      potential   19   172
compositionally biased region   Cys-rich      480   502
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MLHTLLLLLLAELGALLA
Sequence MLHTLLLLLLAELGALLASGPESQSSFLEIIFPEKIEDKTHSEEQISYII
PINKKQYTVHLQKRYFLTNRFMVYMYNQGSTSFHSPNIPAQCYYQGHIKG
YPNSVATLSTCSGLRGFLQFENVSYGIEPLQSAFTSQHIVYKLGNKEKEL
IFNKNSRNIEMPTNYGILINKK
PKSPFKNLFPLYLEMSIVVDKALYDYLG
SDSNIVTNKIIEIISLINSVFAQLKVTIVLSSLELWSDKNKIPTVGEADE
LLHKFLEWKQAYLTLRPHDVAYLFIYNEYPNYMGATYPGKMCTAHYSAGI
TMYPKDMTLEAFSVILTQMLGLSLGISYDEPEKCYCSESICIMNPRAMQY
GGVKSFS
NCSLNDFEHFKSNEGAKCLQNKPQMQRTAAAVCGNGKVEGDEI
CDCGSEAECGPDSCCEPNRCVLKAGRACDSKSPSSTCCKNCQFLPEKHQC
RPEKHLYCDIPEVC
NGSSGNCPPDVTINNGHVCKESGTICYNGDCPDLDR
VC
ESIYGAGSVNAPFACYEEIQGQNDRFGNCGKDNRNRYVFCGWRNLICG
RLICTYPTRMPYNPP
NNSTASVIYAFVRDKVCITVDFGSSVKEDPLRVAN
GATCDLDRICLNGVCVESRFLRD
QSKTCSSKCHGNGVCNSHGVCHCNAGY
SPPNCQ
YPTTKRSASLWSGKHDLPMERASKNQEKKWLLSLYIVLIILASV
FLIGTG
WKGLKQCGSKEEESMSSESKSEDSTYTYVSRSTSETSSMTSTSS
Original MLHTLLLLLLAELGALLASGPESQSSFLEIIFPEKIEDKTHSEEQISYII
PINKKQYTVHLQKRYFLTNRFMVYMYNQGSTSFHSPNIPAQCYYQGHIKG
YPNSVATLSTCSGLRGFLQFENVSYGIEPLQSAFTSQHIVYKLGNKEKEL
IFNKNSRNIEMPTNYGILINKKPKSPFKNLFPLYLEMSIVVDKALYDYLG
SDSNIVTNKIIEIISLINSVFAQLKVTIVLSSLELWSDKNKIPTVGEADE
LLHKFLEWKQAYLTLRPHDVAYLFIYNEYPNYMGATYPGKMCTAHYSAGI
TMYPKDMTLEAFSVILTQMLGLSLGISYDEPEKCYCSESICIMNPRAMQY
GGVKSFSNCSLNDFEHFKSNEGAKCLQNKPQMQRTAAAVCGNGKVEGDEI
CDCGSEAECGPDSCCEPNRCVLKAGRACDSKSPSSTCCKNCQFLPEKHQC
RPEKHLYCDIPEVCNGSSGNCPPDVTINNGHVCKESGTICYNGDCPDLDR
VCESIYGAGSVNAPFACYEEIQGQNDRFGNCGKDNRNRYVFCGWRNLICG
RLICTYPTRMPYNPPNNSTASVIYAFVRDKVCITVDFGSSVKEDPLRVAN
GATCDLDRICLNGVCVESRFLRDQSKTCSSKCHGNGVCNSHGVCHCNAGY
SPPNCQYPTTKRSASLWSGKHDLPMERASKNQEKKWLLSLYIVLIILASV
FLIGTGWKGLKQCGSKEEESMSSESKSEDSTYTYVSRSTSETSSMTSTSS
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11