Signal Peptide Database - Mammalia

 Entry Details
ID   21
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q28483    (Created: 2008-09-02 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ADAM5_MACFA
Protein Name   Disintegrin and metalloproteinase domain-containing protein 5
Gene   ADAM5
Organism Scientific   Macaca fascicularis
Organism Common   Crab eating macaque
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Cercopithecidae
                          Cercopithecinae
                            Macaca
Protein Length [aa]   756
Protein Mass [Da]   85043
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   16
chain   Disintegrin and metalloproteinase domain- containing protein 5      143   756
disulfide bond      by similarity   292   375
disulfide bond      by similarity   334   359
disulfide bond      by similarity   336   341
disulfide bond      by similarity   449   470
disulfide bond      by similarity   634   646
disulfide bond      by similarity   640   652
disulfide bond      by similarity   654   663
transmembrane region      potential   699   719
topological domain   Extracellular   potential   17   698
topological domain   Cytoplasmic   potential   720   756
domain   Peptidase M12B      183   380
domain   Disintegrin      389   478
domain   EGF-like      630   664
glycosylation site   N-linked (GlcNAc...)   potential   559   559
propeptide      potential   17   142
compositionally biased region   Ser-rich      734   755
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MFLLLVLLTGLGGMHA
Sequence MFLLLVLLTGLGGMHADLNPHKTFLQTTIPEKISSSDAKTDPEHNVVYMI
TIEGKPYFVHLKKQSILSSASFIHSYDKNDIRHSKPLLVQMDCNYNGYVA
GIPNSLVTLSVCSGLRGTMQLKNISYGIEPMEAVSGFIHKIY
EEKFADTN
ILLEENDTYSWFNSEYQVRKSSEKTDFIKLFP
RYIEMHIVVDKNLFDYMG
SDINAVTQKVIQIIGLVNTMLTQLQLTVIISSIEIWSNKNKISTTGHAEY
VLLEFFEWKKDHLNFKPHQIAYLFVYRKLPTLIGATFPGQVCNKDFAAAV
ALYPEGLSLESYTVIIVQLLGLNLGLTYDKTDTCHCSGDVCTMTPKAVYS
GGVKDFSVCSLDDFKYISSHNGLTCLQTNP
LEMPTYTQRRICGNGLLEGG
EECDCGNKDNCTHKLCCDALTCRLKDNAQCGSGDCCSKDCKFKPANTICR
KSVDVECDFTEFCNGSYPYCLLDTYVRD
GEYCDSGGAFCFQGRCRTFDKQ
CDDLIGRGSRGAPIFCYDEINTRGDKFGNCGTEYCLFQHILCGKLVCTWE
HKDLISRP
NLSVIYAHVRDQTCVSTYLPSRKPPPVASTVSKTSYYSVDDR
DETFVQDGSVCGPDMYCFKMRCKHVRFLM
DFETCEASIECSGHGICNNFN
HCHCEKGYNPPHCK
PKKEAFGSTDDGHLVPAEKSYMEEGRHAPFQKQRFQ
LIFYISLPVLIITTAILIK
RKKLRELCYRGETESESSVSQESSSNSKSSL
SESTS
L
Original MFLLLVLLTGLGGMHADLNPHKTFLQTTIPEKISSSDAKTDPEHNVVYMI
TIEGKPYFVHLKKQSILSSASFIHSYDKNDIRHSKPLLVQMDCNYNGYVA
GIPNSLVTLSVCSGLRGTMQLKNISYGIEPMEAVSGFIHKIYEEKFADTN
ILLEENDTYSWFNSEYQVRKSSEKTDFIKLFPRYIEMHIVVDKNLFDYMG
SDINAVTQKVIQIIGLVNTMLTQLQLTVIISSIEIWSNKNKISTTGHAEY
VLLEFFEWKKDHLNFKPHQIAYLFVYRKLPTLIGATFPGQVCNKDFAAAV
ALYPEGLSLESYTVIIVQLLGLNLGLTYDKTDTCHCSGDVCTMTPKAVYS
GGVKDFSVCSLDDFKYISSHNGLTCLQTNPLEMPTYTQRRICGNGLLEGG
EECDCGNKDNCTHKLCCDALTCRLKDNAQCGSGDCCSKDCKFKPANTICR
KSVDVECDFTEFCNGSYPYCLLDTYVRDGEYCDSGGAFCFQGRCRTFDKQ
CDDLIGRGSRGAPIFCYDEINTRGDKFGNCGTEYCLFQHILCGKLVCTWE
HKDLISRPNLSVIYAHVRDQTCVSTYLPSRKPPPVASTVSKTSYYSVDDR
DETFVQDGSVCGPDMYCFKMRCKHVRFLMDFETCEASIECSGHGICNNFN
HCHCEKGYNPPHCKPKKEAFGSTDDGHLVPAEKSYMEEGRHAPFQKQRFQ
LIFYISLPVLIITTAILIKRKKLRELCYRGETESESSVSQESSSNSKSSL
SESTSL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11