Signal Peptide Database - Mammalia

 Entry Details
ID   22
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   A2AJA7    (Created: 2007-05-15 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   AEGP_MOUSE
Protein Name   Apical endosomal glycoprotein
Gene   Mamdc4
Organism Scientific   Mus musculus
Organism Common   Mouse
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Mus
Protein Length [aa]   1228
Protein Mass [Da]   134830
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   21
chain   Apical endosomal glycoprotein      22   1228
disulfide bond      by similarity   230   242
disulfide bond      by similarity   237   255
disulfide bond      by similarity   249   266
disulfide bond      by similarity   458   469
disulfide bond      by similarity   465   482
disulfide bond      by similarity   476   491
transmembrane region      potential   1160   1180
topological domain   Extracellular   potential   23   1159
topological domain   Cytoplasmic   potential   1181   1228
domain   LDL-receptor class A 1; truncated      28   49
domain   MAM 1      65   223
domain   LDL-receptor class A 2      229   267
domain   MAM 2      270   426
domain   LDL-receptor class A 3      457   492
domain   MAM 3      492   649
domain   MAM 4      659   815
domain   MAM 5      817   975
domain   MAM 6      977   1144
modified residue   Phosphothreonine   by similarity   198   198
modified residue   Phosphothreonine   by similarity   206   206
glycosylation site   N-linked (GlcNAc...)   potential   204   204
glycosylation site   N-linked (GlcNAc...)   potential   290   290
glycosylation site   N-linked (GlcNAc...)   potential   340   340
glycosylation site   N-linked (GlcNAc...)   potential   641   641
glycosylation site   N-linked (GlcNAc...)   potential   841   841
splice variant   (in isoform 2)      578   656
SP Length   21
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MCLPSHLLSTWVLFMAAQSLG
Sequence MCLPSHLLSTWVLFMAAQSLGKTWLPNHCRSPIKAVCNFVCDCGDCSDET
QCGFHGASTIPSTS
FTCNFEQDSCGWQDISTSGYRWLRDRAGAVLHGPGP
HSDHTHGTDLGWYMAVGTHSGKEPSTATLRSPVMREAAPTCELRLWYHIA
SRDVAELRLDLTHGVETLTLWQTSGPWGPGWQELAVNTGRIQGDFKV
TFS
ATR
NATHRGAVALDDVEFRDCGLPIPQARCPLGHHHCQNKACVEPHQLCD
GEDNCGDRSDEDPLICS
HHMATDFETGLGPWNQLEGWTRNHSAGSMVSPA
WPHRDHSRNSAYGFFLISVAKPGTTAVLYSPEFQGSVSN
NCSFTFYYYLH
GSEASHFQLFLQAQGLNTPQVPVLLRSRHGELGTAWVRDRVDIQSAHPFR
ILLAGETGPGGVVGLDDLIMSSHCML
VPAMSTLQSSLSGPVPLALYPQTS
IKLPQQ
TCEPGHLSCGDLCVPPEQLCDFQKHCAEGEDEHKCGTTDFESAS
AGGWEDISVGKLQWQWVEAQEKSKPAGDANRDAPGHFLSLQKAWGQLRSE
ARALTPALGPSGPHCELHMAYYFQSHP
QGFLALVVVENGFRELLWQAPGG
GSGSWTEEKIILGARRRPFQLEFVSLVDLDGPGQQGAGVDNVTLRDCNPM
VTTESD
QELSCNFERDSCSWHTGHLTDAHWHRIKSHGSQLDHTTGQGFFM
FLDPTDPPARGQGALLLTRPQVPVVPKECLSFWYRLYGPQIGTLCLAMRR
EREEDILLWSRSGTHGNRWHQAWVTLHHQPEASTKYQLLFEGLRNGYHGT
MALDDIAVRPGPCWA
PKSCSFEDSDCGFSPGGWGLWTHQSNASGLASWGP
WIDHTTGTAQGHYMVVDTSPNVLPKGHVAALTSEEHQPLSQPACLTFWYH
MSVPNPGTLRVHVEESTRRQELSISAHGRSAWRLGSVNVQAEQAWKVVFE
AVAAGVEYSYMALDDISLQDGPCPQ
PGSCDFETGLCGWSHLPWPSLGGYS
WDWSSGATPSRYPQPSVDHTLGTEAGHFAFFETSVLGPGGQAAWLRSEPL
PATTVSCLRFWYYMGFPEHFYKGELRVLLSSARGQLAVWYQGGHLRDQWL
QVQIELSNSEEFQIVFEATLGGQPALGPIAIDDVQYLAGQQCKQ
PSPSQG
EVAAPVSVP
VAVGGALLFFMFLVLMGLGGWHWLQKQHCPGQRSTDAAASG
FANILFNADHVTLPESITSNPQSPPDLA
Original MCLPSHLLSTWVLFMAAQSLGKTWLPNHCRSPIKAVCNFVCDCGDCSDET
QCGFHGASTIPSTSFTCNFEQDSCGWQDISTSGYRWLRDRAGAVLHGPGP
HSDHTHGTDLGWYMAVGTHSGKEPSTATLRSPVMREAAPTCELRLWYHIA
SRDVAELRLDLTHGVETLTLWQTSGPWGPGWQELAVNTGRIQGDFKVTFS
ATRNATHRGAVALDDVEFRDCGLPIPQARCPLGHHHCQNKACVEPHQLCD
GEDNCGDRSDEDPLICSHHMATDFETGLGPWNQLEGWTRNHSAGSMVSPA
WPHRDHSRNSAYGFFLISVAKPGTTAVLYSPEFQGSVSNNCSFTFYYYLH
GSEASHFQLFLQAQGLNTPQVPVLLRSRHGELGTAWVRDRVDIQSAHPFR
ILLAGETGPGGVVGLDDLIMSSHCMLVPAMSTLQSSLSGPVPLALYPQTS
IKLPQQTCEPGHLSCGDLCVPPEQLCDFQKHCAEGEDEHKCGTTDFESAS
AGGWEDISVGKLQWQWVEAQEKSKPAGDANRDAPGHFLSLQKAWGQLRSE
ARALTPALGPSGPHCELHMAYYFQSHPQGFLALVVVENGFRELLWQAPGG
GSGSWTEEKIILGARRRPFQLEFVSLVDLDGPGQQGAGVDNVTLRDCNPM
VTTESDQELSCNFERDSCSWHTGHLTDAHWHRIKSHGSQLDHTTGQGFFM
FLDPTDPPARGQGALLLTRPQVPVVPKECLSFWYRLYGPQIGTLCLAMRR
EREEDILLWSRSGTHGNRWHQAWVTLHHQPEASTKYQLLFEGLRNGYHGT
MALDDIAVRPGPCWAPKSCSFEDSDCGFSPGGWGLWTHQSNASGLASWGP
WIDHTTGTAQGHYMVVDTSPNVLPKGHVAALTSEEHQPLSQPACLTFWYH
MSVPNPGTLRVHVEESTRRQELSISAHGRSAWRLGSVNVQAEQAWKVVFE
AVAAGVEYSYMALDDISLQDGPCPQPGSCDFETGLCGWSHLPWPSLGGYS
WDWSSGATPSRYPQPSVDHTLGTEAGHFAFFETSVLGPGGQAAWLRSEPL
PATTVSCLRFWYYMGFPEHFYKGELRVLLSSARGQLAVWYQGGHLRDQWL
QVQIELSNSEEFQIVFEATLGGQPALGPIAIDDVQYLAGQQCKQPSPSQG
EVAAPVSVPVAVGGALLFFMFLVLMGLGGWHWLQKQHCPGQRSTDAAASG
FANILFNADHVTLPESITSNPQSPPDLA
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11