Signal Peptide Database - Mammalia

 Entry Details
ID   3
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P01892    (Created: 1986-07-21 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   1A02_HUMAN
Protein Name   HLA class I histocompatibility antigen, A-2 alpha chain
Gene   HLA-A
Organism Scientific   Homo sapiens
Organism Common   Human
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Homo
Protein Length [aa]   365
Protein Mass [Da]   40922
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   24
chain   HLA class I histocompatibility antigen, A-2 alpha chain      25   365
disulfide bond         125   188
disulfide bond         227   283
transmembrane region      potential   309   332
topological domain   Extracellular   potential   25   308
topological domain   Cytoplasmic   potential   333   365
domain   Ig-like C1-type      209   295
region of interest   Alpha-1      25   114
region of interest   Alpha-2      115   206
region of interest   Alpha-3      207   298
region of interest   Connecting peptide      299   308
modified residue   Phosphoserine      352   352
modified residue   Phosphoserine      356   356
glycosylation site   N-linked (GlcNAc...)      110   110
sequence variant   (in allele A*0203, allele A*0213)      0   0
sequence variant   (in allele A*0203)      0   0
sequence variant   (in allele A*0218)      0   0
sequence variant   (in allele A*0210)      0   0
sequence variant   (in allele A*0212, allele A*0213, allele A*0237)      0   0
sequence variant   (in allele A*0202, allele A*0203, allele A*0205, allele A*0208)      0   0
sequence variant   (in allele A*0216; requires 2 nucleotide substitutions)      0   0
sequence variant   (in allele A*0236, allele A*0237)      0   0
sequence variant   (in allele A*0236, allele A*0237)      0   0
sequence variant   (in allele A*0209)      0   0
sequence variant   (in allele A*0210, allele A*0217)      0   0
sequence variant   (in allele A*0207, allele A*0218)      0   0
sequence variant   (in allele A*0205, allele A*0206, allele A*0208, allele A*0210, allele A*0221)      0   0
sequence variant   (in allele A*0221)      0   0
sequence variant   (in allele A*0231)      0   0
sequence variant   (in allele A*0202, allele A*0205, allele A*0208)      0   0
sequence variant   (in allele A*0208, allele A*0220)      0   0
sequence variant   (in allele A*0234, allele A*0235)      0   0
sequence variant   (in allele A*0211)      0   0
sequence variant   (in allele A*0211, allele A*0235)      0   0
sequence variant   (in allele A*0202, allele A*0205, allele A*0208, allele A*0217)      0   0
sequence variant   (in allele A*0204, allele A*0217)      0   0
strand         27   36
strand         41   43
strand         45   52
strand         55   61
strand         64   66
strand         113   115
strand         118   127
strand         131   142
strand         145   150
strand         154   161
strand         210   235
strand         238   243
strand         246   248
strand         252   254
strand         261   263
strand         265   274
strand         281   286
strand         294   297
helix         74   76
helix         81   108
helix         162   173
helix         176   184
helix         187   198
helix         200   203
helix         278   280
SP Length   24
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MAVMAPRTLVLLLSGALALTQTWA
Sequence MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVG
YV
DDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRV
DLGTLRGY
YNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIAL
KEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGK
ETL
QRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQ
D
TELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEP
SSQPTIPI
VGIIAGLVLFGAVITGAVVAAVMWRRKSSDRKGGSYSQAASS
D
SAQGSDVSLTACKV
Original MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVG
YVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRV
DLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIAL
KEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGK
ETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQ
DTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEP
SSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRKGGSYSQAASS
DSAQGSDVSLTACKV
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11