Signal Peptide Database - Mammalia

 Entry Details
ID   39
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P00688    (Created: 1986-07-21 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   AMYP_MOUSE
Protein Name   Pancreatic alpha-amylase
Gene   Amy2
Organism Scientific   Mus musculus
Organism Common   Mouse
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Mus
Protein Length [aa]   508
Protein Mass [Da]   57417
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   15
chain   Pancreatic alpha-amylase      16   508
disulfide bond      by similarity   43   101
disulfide bond      by similarity   85   130
disulfide bond      by similarity   156   172
disulfide bond      by similarity   390   396
disulfide bond      by similarity   462   474
modified residue   Pyrrolidone carboxylic acid      16   16
sequence variant   (in A1, B(A), B(C))      0   0
sequence variant   (in A1, B(A), B(C); requires 2 nucleotide substitutions)      0   0
sequence variant   (in A1, B(C))      0   0
sequence variant   (in B(A))      0   0
sequence variant   (in A1, B(C))      0   0
sequence variant   (in A1, B(C))      0   0
sequence variant   (in A1, B(A), B(C))      0   0
sequence variant   (in B(A))      0   0
sequence variant   (in B1)      0   0
sequence variant   (in AMY-2.2Y)      0   0
sequence variant   (in A1, B(C), AMY-2.2Y)      0   0
sequence variant   (in B(C))      0   0
active site   Nucleophile   by similarity   209   209
active site   Proton donor   by similarity   245   245
active site      by similarity   312   312
metal ion-binding site   Calcium   by similarity   115   115
metal ion-binding site   Calcium; via carbonyl oxygen   by similarity   170   170
metal ion-binding site   Calcium   by similarity   179   179
metal ion-binding site   Calcium; via carbonyl oxygen   by similarity   213   213
binding site   Chloride   by similarity   207   207
binding site   Chloride   by similarity   310   310
binding site   Chloride   by similarity   349   349
SP Length   15
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKFVLLLSLIGFCWA
Sequence MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECERYLAPK
GFGGVQVSPPNENVVVHNPSRPWWERYQPISYKI
CTRSGNEDEFRDMVTR
CNNVGVRIYVDAVI
NHMCGAGNPAGTSSTCGSYLNPNNREFPAVPYSAWD
FNDNK
CNGEIDNYNDAYQVRNCRLTGLLDLALEKDYVRTKVADYMNHLID
IGVAGF
RLDAAKHMWPRDIKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLG
GEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGLVP
SDRALVFVD
NHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRV
MSSYRWNRNFQNGKDQNDWIGPPNNNGVTKEVTINADTT
CGNDWVCEHRW
RQIRNMVAFRNVVNGQPFSNWWDNNSNQVAFSRGNRGFIVFNNDDWALSA
TLQTGLPAGTY
CDVISGDKVDGNCTGLRVNVGSDGKAHFSISNSAEDPFI
AIHADSKL
Original MKFVLLLSLIGFCWAQYDPHTSDGRTAIVHLFEWRWVDIAKECERYLAPK
GFGGVQVSPPNENVVVHNPSRPWWERYQPISYKICTRSGNEDEFRDMVTR
CNNVGVRIYVDAVINHMCGAGNPAGTSSTCGSYLNPNNREFPAVPYSAWD
FNDNKCNGEIDNYNDAYQVRNCRLTGLLDLALEKDYVRTKVADYMNHLID
IGVAGFRLDAAKHMWPRDIKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLG
GEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGLVP
SDRALVFVDNHDNQRGHGAGGSSILTFWDARMYKMAVGFMLAHPYGFTRV
MSSYRWNRNFQNGKDQNDWIGPPNNNGVTKEVTINADTTCGNDWVCEHRW
RQIRNMVAFRNVVNGQPFSNWWDNNSNQVAFSRGNRGFIVFNNDDWALSA
TLQTGLPAGTYCDVISGDKVDGNCTGLRVNVGSDGKAHFSISNSAEDPFI
AIHADSKL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11