Signal Peptide Database - Mammalia

 Entry Details
ID   42
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P13205    (Created: 1990-01-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ANFB_RAT
Protein Name   Natriuretic peptides B
Gene   Nppb
Organism Scientific   Rattus norvegicus
Organism Common   Rat
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Rattus
Protein Length [aa]   121
Protein Mass [Da]   13656
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   26
disulfide bond         99   115
peptide   Natriuretic peptides B. /FTId=PRO_0000001538      27   121
peptide   Brain natriuretic peptide 45. /FTId=PRO_0000001539      77   121
SP Length   26
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MDLQKVLPQMILLLLFLNLSPLGGHS
Sequence MDLQKVLPQMILLLLFLNLSPLGGHSHPLGSPSQSPEQSTMQKLLELIRE
KSEEMAQRQLSKDQGPTKELLKRVLR
SQDSAFRIQERLRNSKMAHSSSCF
GQKIDRIGAVSRLGCDGLRLF
Original MDLQKVLPQMILLLLFLNLSPLGGHSHPLGSPSQSPEQSTMQKLLELIRE
KSEEMAQRQLSKDQGPTKELLKRVLRSQDSAFRIQERLRNSKMAHSSSCF
GQKIDRIGAVSRLGCDGLRLF
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11