Signal Peptide Database - Mammalia

 Entry Details
ID   43
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P01161    (Created: 1986-07-21 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ANF_RAT
Protein Name   Atrial natriuretic factor
Gene   Nppa
Organism Scientific   Rattus norvegicus
Organism Common   Rat
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Rattus
Protein Length [aa]   152
Protein Mass [Da]   16556
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   24
disulfide bond         129   145
propeptide         25   125
peptide   Auriculin-B. /FTId=PRO_0000001506      126   150
peptide   Auriculin-A. /FTId=PRO_0000001507      126   149
peptide   Atriopeptin-3. /FTId=PRO_0000001508      127   150
peptide   Atriopeptin-2. /FTId=PRO_0000001509      127   149
peptide   Atriopeptin-1. /FTId=PRO_0000001510      127   147
turn         136   139
SP Length   24
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MGSFSITKGFFLFLAFWLPGHIGA
Sequence MGSFSITKGFFLFLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKM
PVEDEVMPPQALSEQTDEAGAALSSLSEVPPWTGEVNPSQRDGGALGRGP
WDPSDRSALLKSKLRALLAGPRSLR
RSSCFGGRIDRIGAQSGLGCNSFRY
RR
Original MGSFSITKGFFLFLAFWLPGHIGANPVYSAVSNTDLMDFKNLLDHLEEKM
PVEDEVMPPQALSEQTDEAGAALSSLSEVPPWTGEVNPSQRDGGALGRGP
WDPSDRSALLKSKLRALLAGPRSLRRSSCFGGRIDRIGAQSGLGCNSFRY
RR
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11