Signal Peptide Database - Mammalia

 Entry Details
ID   44
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q861Y2    (Created: 2005-04-12 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ANGI_PYGBI
Protein Name   Angiogenin
Gene   ANG
Organism Scientific   Pygathrix bieti
Organism Common   Black snub-nosed monkey
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Cercopithecidae
                          Colobinae
                            Rhinopithecus
Protein Length [aa]   146
Protein Mass [Da]   16438
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   24
chain   Angiogenin      25   146
disulfide bond      by similarity   50   105
disulfide bond      by similarity   63   116
disulfide bond      by similarity   81   131
region of interest   Substrate binding   by similarity   64   68
modified residue   Pyrrolidone carboxylic acid   by similarity   25   25
active site   Proton acceptor   by similarity   37   37
active site   Proton donor   by similarity   138   138
SP Length   24
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MVMGLGLFLLVFMLGLGLTPPTLA
Sequence MVMGLGLFLLVFMLGLGLTPPTLAQDNSRYRDFLTKHYDATPQGRNDRYC
ESMMRRRGLTSP
CKDINTFIHGNSRHIKAICGDENGNPYGENLRISKSPF
QVTTCNLRGGSSRPPCRYRATAGFRNIVVAC
ENDLPVHLDQSIFRP
Original MVMGLGLFLLVFMLGLGLTPPTLAQDNSRYRDFLTKHYDATPQGRNDRYC
ESMMRRRGLTSPCKDINTFIHGNSRHIKAICGDENGNPYGENLRISKSPF
QVTTCNLRGGSSRPPCRYRATAGFRNIVVACENDLPVHLDQSIFRP
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11