Signal Peptide Database - Mammalia

 Entry Details
ID   45
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   O35460    (Created: 2000-12-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   ANGP1_RAT
Protein Name   Angiopoietin-1
Gene   Angpt1
Organism Scientific   Rattus norvegicus
Organism Common   Rat
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Rattus
Protein Length [aa]   497
Protein Mass [Da]   57461
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Angiopoietin-1      20   497
disulfide bond      by similarity   285   314
disulfide bond      by similarity   438   451
domain   Fibrinogen C-terminal      276   496
glycosylation site   N-linked (GlcNAc...)   potential   92   92
glycosylation site   N-linked (GlcNAc...)   potential   122   122
glycosylation site   N-linked (GlcNAc...)   potential   154   154
glycosylation site   N-linked (GlcNAc...)   potential   243   243
glycosylation site   N-linked (GlcNAc...)   potential   294   294
coiled-coil region      potential   81   119
coiled-coil region      potential   153   261
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MTVFLSFAFFAAILTHIGC
Sequence MTVFLSFAFFAAILTHIGCSNQRRSPENGGRRYNRIQHGQCAYTFILPEH
DGNCRESATEQYNTNALQRDAPHVETDFSS
QKLQHLEHVMENYTQWLQKL
ENYIVENMKSEMAQIQQNA
VQNHTATMLEIGTSLLSQTAEQTRKLTDVET
QV
LNQTSRLEIQLLENSLSTYELEKQLLQQTNEILKIQEKNSLLEHKILE
MEGKHKEELDTLKEEKENLQGLVTRQTFIIQELEKQLSRATSNNSVLQKQ
QLELMDTVHNL
VSLCTKEVLLKGGKREEEKPFRDCADVYQAGFNKSGIYT
IYFNNMPEPKKVFCNMDVNEGGWTVIQHREDGSLDFQRGWKEYKMGFGNP
SGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNQKQNY
RLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDA
CGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLD
F
Original MTVFLSFAFFAAILTHIGCSNQRRSPENGGRRYNRIQHGQCAYTFILPEH
DGNCRESATEQYNTNALQRDAPHVETDFSSQKLQHLEHVMENYTQWLQKL
ENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLSQTAEQTRKLTDVET
QVLNQTSRLEIQLLENSLSTYELEKQLLQQTNEILKIQEKNSLLEHKILE
MEGKHKEELDTLKEEKENLQGLVTRQTFIIQELEKQLSRATSNNSVLQKQ
QLELMDTVHNLVSLCTKEVLLKGGKREEEKPFRDCADVYQAGFNKSGIYT
IYFNNMPEPKKVFCNMDVNEGGWTVIQHREDGSLDFQRGWKEYKMGFGNP
SGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNQKQNY
RLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDA
CGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11