Signal Peptide Database - Mammalia

 Entry Details
ID   47
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P18910    (Created: 1990-11-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   ANPRA_RAT
Protein Name   Atrial natriuretic peptide receptor A
Gene   Npr1
Organism Scientific   Rattus norvegicus
Organism Common   Rat
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Rattus
Protein Length [aa]   1057
Protein Mass [Da]   118951
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   28
chain   Atrial natriuretic peptide receptor A      29   1057
disulfide bond         88   114
disulfide bond         192   241
disulfide bond         451   460
transmembrane region      potential   470   490
topological domain   Extracellular   potential   29   469
topological domain   Cytoplasmic   potential   491   1057
domain   Protein kinase      524   801
domain   Guanylate cyclase      872   1002
modified residue   Phosphoserine      525   525
modified residue   Phosphothreonine      528   528
modified residue   Phosphoserine      530   530
modified residue   Phosphoserine      534   534
modified residue   Phosphoserine      538   538
modified residue   Phosphothreonine      541   541
glycosylation site   N-linked (GlcNAc...)      41   41
glycosylation site   N-linked (GlcNAc...)      208   208
glycosylation site   N-linked (GlcNAc...)   potential   334   334
glycosylation site   N-linked (GlcNAc...)   potential   375   375
glycosylation site   N-linked (GlcNAc...)   potential   382   382
glycosylation site   N-linked (GlcNAc...)      423   423
strand         30   37
strand         73   80
strand         86   88
strand         107   110
strand         132   135
strand         151   153
strand         176   183
strand         186   188
strand         210   216
strand         236   242
strand         265   269
strand         291   293
strand         305   310
strand         383   387
strand         390   394
strand         398   400
strand         404   409
strand         416   422
strand         429   432
helix         48   63
helix         92   104
helix         115   128
helix         140   143
helix         158   172
helix         191   207
helix         221   223
helix         224   234
helix         244   256
helix         295   301
helix         302   304
helix         316   333
helix         341   343
helix         344   365
helix         373   378
binding site   Chloride      81   81
binding site   Chloride; via amide nitrogen      113   113
binding site   Chloride; via amide nitrogen      114   114
mutagenesis site   Abolishes hormone binding      0   0
mutagenesis site   Abolishes hormone binding      0   0
mutagenesis site   No effect on phosphorylation, 15% loss of ANP-dependent activity      0   0
mutagenesis site   No effect on ANP-dependent activity      0   0
mutagenesis site   Reduced phosphorylation, 80% loss of ANP-dependent activity      0   0
mutagenesis site   No effect on phosphorylation, 30% loss of ANP-dependent activity      0   0
mutagenesis site   Markedly reduced phosphorylation, 50% loss of CNP-dependent activity      0   0
mutagenesis site   Reduced phosphorylation, 60% loss of CNP-dependent activity      0   0
mutagenesis site   Reduced phosphorylation, 50% loss of ANP-dependent activity      0   0
mutagenesis site   Reduced phosphorylation, 50% loss of ANP-dependent activity      0   0
mutagenesis site   Reduced phosphorylation, 50% loss of ANP-dependent activity      0   0
turn         145   147
turn         261   263
turn         379   382
turn         411   413
turn         424   426
SP Length   28
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MPGSRRVRPRLRALLLLPPLLLLRGGHA
Sequence MPGSRRVRPRLRALLLLPPLLLLRGGHASDLTVAVVLPLTNTSYPWSWAR
VGPAVELALARVK
ARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDL
KWEH
SPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYAL
TTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLY
MRVRERL
NITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNL
MLLALN
AGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQ
A
FQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFH
DGLLLYVQAVTETLA
QGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDR
DTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPK
CGFDNEDPACNQDHFSTLE
VLALVGSLSLISFLIVSFFIYRKMQLEKELV
SELWRVRWEDLQPSSLERHLRSA
GSRLTLSGRGSNYGSLLTTEGQFQVFA
KTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTD
PPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGA
ICSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEPEQGHTLFAKKLWTAP
ELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKEIIER
VTRGEQPPFRPSMDLQSHLEELGQLMQRCWAEDPQERPPFQQIRLALRKF
N
KENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILP
HSVAEQLKRGETVQAEAFDSV
TIYFSDIVGFTALSAESTPMQVVTLLNDL
YTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLD
AVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASR
ME
SNGEALKIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGE
RGCSTRG
Original MPGSRRVRPRLRALLLLPPLLLLRGGHASDLTVAVVLPLTNTSYPWSWAR
VGPAVELALARVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDL
KWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYAL
TTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLY
MRVRERLNITVNHQEFVEGDPDHYPKLLRAVRRKGRVIYICSSPDAFRNL
MLLALNAGLTGEDYVFFHLDVFGQSLKSAQGLVPQKPWERGDGQDRSARQ
AFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTVEDGLKNIIPASFH
DGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDR
DTDFSLWDMDPETGAFRVVLNYNGTSQELMAVSEHKLYWPLGYPPPDVPK
CGFDNEDPACNQDHFSTLEVLALVGSLSLISFLIVSFFIYRKMQLEKELV
SELWRVRWEDLQPSSLERHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFA
KTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVGACTD
PPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGA
ICSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEPEQGHTLFAKKLWTAP
ELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKEIIER
VTRGEQPPFRPSMDLQSHLEELGQLMQRCWAEDPQERPPFQQIRLALRKF
NKENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILP
HSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDL
YTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGQLHAREVARMALALLD
AVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASR
MESNGEALKIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLLGE
RGCSTRG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11