Signal Peptide Database - Mammalia

 Entry Details
ID   48
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q8BLS7    (Created: 2006-06-27 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   ANR43_MOUSE
Protein Name   Ankyrin repeat domain-containing protein 43
Gene   Ankrd43
Organism Scientific   Mus musculus
Organism Common   Mouse
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Mus
Protein Length [aa]   548
Protein Mass [Da]   57749
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   19
chain   Ankyrin repeat domain-containing protein 43      20   548
repeat   ANK 1      344   373
repeat   ANK 2      383   413
compositionally biased region   Ala-rich      2   20
compositionally biased region   Pro-rich      85   225
SP Length   19
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MALAAAAAAAAAAAGVSQA
Sequence MALAAAAAAAAAAAGVSQAAVLGFLREHGGQVRNSELLSRFKPLLDAGDP
RGRAARRDRFKQFVNNVAVVKELDGVKFVVLRKK
PRPPEGPEAPLPSSPG
VPAALAQCAAVPAEDNCAPGAPHSPQRSGEPPEDSSAPSELQHTPETLPS
EVTQVEAPSGSAPQPGGPEDPALPRSSELARPASVPSGLALTSTESPGPE
PAPPTAQVPPQKPCMLPVRCVVPGP
AALRIRAEEQGLRRQRSEEPSPRGS
PMLLRRLSVEESGLGLHLGPGRSPHLRRLSRAGPRLLSPDTEEMPVAPLP
SPAVPLEPTEHEWLVRTASGRWSHQLHGLLLRDRGLAAKRDFM
SGFTALH
WAAKNGDREMALQLVEVARRGGA
PVDVNARSHGGYTPLHLAALHGHEDAA
VLLVVRLGAQVHV
RDYSGRRAYQYLRPGSSYALRRLLGDPGLRSMMEPDA
ASGGSGSLVSRHPVQVAATILSSTTSAFLGVLADDLMLQDLARGLKKSSS
FSKFLGASPMAPRKKTKIRGGLPSFTEISHRSTPGPLAGLVPSLPPPT
Original MALAAAAAAAAAAAGVSQAAVLGFLREHGGQVRNSELLSRFKPLLDAGDP
RGRAARRDRFKQFVNNVAVVKELDGVKFVVLRKKPRPPEGPEAPLPSSPG
VPAALAQCAAVPAEDNCAPGAPHSPQRSGEPPEDSSAPSELQHTPETLPS
EVTQVEAPSGSAPQPGGPEDPALPRSSELARPASVPSGLALTSTESPGPE
PAPPTAQVPPQKPCMLPVRCVVPGPAALRIRAEEQGLRRQRSEEPSPRGS
PMLLRRLSVEESGLGLHLGPGRSPHLRRLSRAGPRLLSPDTEEMPVAPLP
SPAVPLEPTEHEWLVRTASGRWSHQLHGLLLRDRGLAAKRDFMSGFTALH
WAAKNGDREMALQLVEVARRGGAPVDVNARSHGGYTPLHLAALHGHEDAA
VLLVVRLGAQVHVRDYSGRRAYQYLRPGSSYALRRLLGDPGLRSMMEPDA
ASGGSGSLVSRHPVQVAATILSSTTSAFLGVLADDLMLQDLARGLKKSSS
FSKFLGASPMAPRKKTKIRGGLPSFTEISHRSTPGPLAGLVPSLPPPT
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11