Signal Peptide Database - Mammalia

 Entry Details
ID   49
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q29437    (Created: 1997-11-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   AOCX_BOVIN
Protein Name   Primary amine oxidase, liver isozyme
Gene  
Organism Scientific   Bos taurus
Organism Common   Bovine
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Laurasiatheria
                  Cetartiodactyla
                    Ruminantia
                      Pecora
                        Bovidae
                          Bovinae
                            Bos
Protein Length [aa]   762
Protein Mass [Da]   84757
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   16
chain   Primary amine oxidase, liver isozyme      17   762
modified residue   2',4',5'-topaquinone      470   470
glycosylation site   N-linked (GlcNAc...)      136   136
glycosylation site   N-linked (GlcNAc...)      231   231
glycosylation site   N-linked (GlcNAc...)      665   665
strand         92   101
strand         122   129
strand         131   134
strand         136   147
strand         150   153
strand         207   210
strand         216   218
strand         223   230
strand         241   249
strand         252   254
strand         259   265
strand         268   271
strand         323   325
strand         328   330
strand         332   341
strand         345   353
strand         356   371
strand         382   384
strand         407   417
strand         422   434
strand         457   467
strand         470   478
strand         484   492
strand         507   511
strand         514   517
strand         519   529
strand         533   550
strand         553   568
strand         575   577
strand         585   593
strand         599   607
strand         629   635
strand         669   683
strand         700   712
helix         64   77
helix         85   87
helix         105   114
helix         155   159
helix         165   167
helix         172   184
helix         187   190
helix         191   198
helix         255   257
helix         273   281
helix         376   380
helix         385   387
helix         503   506
helix         571   574
helix         621   628
helix         659   662
helix         687   689
active site   Proton acceptor   by similarity   385   385
active site   Schiff-base intermediate with substrate; via topaquinone   by similarity   470   470
metal ion-binding site   Copper      519   519
metal ion-binding site   Copper      521   521
metal ion-binding site   Calcium 1      528   528
metal ion-binding site   Calcium 1; via carbonyl oxygen      529   529
metal ion-binding site   Calcium 1      530   530
metal ion-binding site   Calcium 2      571   571
metal ion-binding site   Calcium 2   by similarity   637   637
metal ion-binding site   Calcium 2; via carbonyl oxygen      662   662
metal ion-binding site   Calcium 2      664   664
metal ion-binding site   Calcium 2      666   666
metal ion-binding site   Calcium 1      672   672
metal ion-binding site   Calcium 1; via carbonyl oxygen      673   673
metal ion-binding site   Copper      683   683
turn         200   203
turn         342   344
turn         390   393
turn         399   401
turn         646   650
SP Length   16
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MFIFIFLSLWTLLVMG
Sequence MFIFIFLSLWTLLVMGREEGGVGSEEGVGKQCHPSLPPRCPSRSPSDQPW
THPDQSQLFADLS
REELTTVMSFLTQQLGPDLVDAAQARPSDNCVFSVEL
Q
LPPKAAALAHLDRGSPPPAREALAIVFFGGQPQPNVTELVVGPLPQPSY
MRD
VTVERHGGPLPYYRRPVLLREYLDIDQMIFNRELPQAAGVLHHCCSY
KQG
GQKLLTMNSAPRGVQSGDRSTWFGIYYNITKGGPYLHPVGLELLVDH
K
ALDPADWTVQKVFFQGRYYENLAQLEEQFEAGQVNVVVIPDDGTGGFWS
LKSQVPPGPTPPLQFHPQGPRF
SVQGNRVASSLWTFSFGLGAFSGPRVFD
VRF
QGERLAYEISLQEAGAVYGGNTPAAMLTRYMDSGFGMGYFATPLIRG
V
DCPYLATYMDWHFVVESQTPKTLHDAFCVFEQNKGLPLRRHHSDFLSHY
FGGVAQ
TVLVFRSVSTMLNYDYVWDMVFYPNGAIEVKLHATGYISSAFLF
GA
ARRYGNQVGEHTLGPVHTHSAHYKVDLDVGGLENWVWAEDMAFVPTAI
PWSPEHQIQRLQVTRKQLETEEQAAFPLGGASPRYLYLASKQSNKWGHPR
GYRIQTV
SFAGGPMPQNSPMERAFSWGRYQLAITQRKETEPSSSSVFNQN
DPWTPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGV
GFFLRPYNFFDQ
EPSMDSADSIYFREGQDAGSCEINPLACLPQAATCAPD
LPVFSHGGYPEY
Original MFIFIFLSLWTLLVMGREEGGVGSEEGVGKQCHPSLPPRCPSRSPSDQPW
THPDQSQLFADLSREELTTVMSFLTQQLGPDLVDAAQARPSDNCVFSVEL
QLPPKAAALAHLDRGSPPPAREALAIVFFGGQPQPNVTELVVGPLPQPSY
MRDVTVERHGGPLPYYRRPVLLREYLDIDQMIFNRELPQAAGVLHHCCSY
KQGGQKLLTMNSAPRGVQSGDRSTWFGIYYNITKGGPYLHPVGLELLVDH
KALDPADWTVQKVFFQGRYYENLAQLEEQFEAGQVNVVVIPDDGTGGFWS
LKSQVPPGPTPPLQFHPQGPRFSVQGNRVASSLWTFSFGLGAFSGPRVFD
VRFQGERLAYEISLQEAGAVYGGNTPAAMLTRYMDSGFGMGYFATPLIRG
VDCPYLATYMDWHFVVESQTPKTLHDAFCVFEQNKGLPLRRHHSDFLSHY
FGGVAQTVLVFRSVSTMLNYDYVWDMVFYPNGAIEVKLHATGYISSAFLF
GAARRYGNQVGEHTLGPVHTHSAHYKVDLDVGGLENWVWAEDMAFVPTAI
PWSPEHQIQRLQVTRKQLETEEQAAFPLGGASPRYLYLASKQSNKWGHPR
GYRIQTVSFAGGPMPQNSPMERAFSWGRYQLAITQRKETEPSSSSVFNQN
DPWTPTVDFSDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGV
GFFLRPYNFFDQEPSMDSADSIYFREGQDAGSCEINPLACLPQAATCAPD
LPVFSHGGYPEY
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11