Signal Peptide Database - Mammalia

 Entry Details
ID   51
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q9R0R3    (Created: 2002-01-23 Updated: 2008-11-04)
UniProtKB/Swiss-Prot Entry Name   APEL_RAT
Protein Name   Apelin
Gene   Apln
Organism Scientific   Rattus norvegicus
Organism Common   Rat
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Rattus
Protein Length [aa]   77
Protein Mass [Da]   8677
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   22
modified residue   Pyrrolidone carboxylic acid   by similarity   65   65
propeptide      by similarity   23   41
peptide   Apelin-36. /FTId=PRO_0000001770      42   77
peptide   Apelin-31 (By similarity). /FTId=PRO_0000001771      47   77
peptide   Apelin-28 (By similarity). /FTId=PRO_0000001772      50   77
peptide   Apelin-13. /FTId=PRO_0000001773      65   77
SP Length   22
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MNLSFCVQALLLLWLSLTAVCG
Sequence MNLSFCVQALLLLWLSLTAVCGVPLMLPPDGKGLEEGNMRYLVKPRTSRT
GPGAWQGGRRKFRR
QRPRLSHKGPMPF
Original MNLSFCVQALLLLWLSLTAVCGVPLMLPPDGKGLEEGNMRYLVKPRTSRT
GPGAWQGGRRKFRRQRPRLSHKGPMPF
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11