Signal Peptide Database - Mammalia

 Entry Details
ID   54
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P15943    (Created: 1990-04-01 Updated: 2008-11-25)
UniProtKB/Swiss-Prot Entry Name   APLP2_RAT
Protein Name   Amyloid-like protein 2
Gene   Aplp2
Organism Scientific   Rattus norvegicus
Organism Common   Rat
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Rattus
Protein Length [aa]   765
Protein Mass [Da]   86883
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   29
chain   Amyloid-like protein 2      30   765
disulfide bond      by similarity   312   362
disulfide bond      by similarity   321   345
disulfide bond      by similarity   337   358
transmembrane region      potential   696   718
topological domain   Extracellular   potential   30   695
topological domain   Cytoplasmic   potential   719   765
domain   BPTI/Kunitz inhibitor      308   366
modified residue   Phosphotyrosine   by similarity   752   752
modified residue   Phosphotyrosine   by similarity   757   757
glycosylation site   O-linked (Xyl...) (glycosaminoglycan)   potential   628   628
site   Reactive bond   by similarity   322   323
splice variant   (in isoform C, isoform D)      311   365
splice variant   (in isoform B, isoform D)      616   627
compositionally biased region   Poly-Glu      218   229
compositionally biased region   Asp/Glu-rich (highly acidic)      218   282
SP Length   29
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MAATGTAAAAATGKLLVLLLLGLTAPAAA
Sequence MAATGTAAAAATGKLLVLLLLGLTAPAAALAGYIEALAANAGTGFAVAEP
QIAMFCGKLNMHVNIQTGKWEPDPTGTKSCLGTKEEVLQYCQEIYPELQI
TNVMEANQPVNIDSWCRRDKKQCRSHIVIPFKCLVGEFVSDVLLVPENCQ
FFHQERMEVCEKHQRWHTVVKEACLTEGMTLYSYGMLLPCGVDQFHGTEY
VCCPQTKVVDSDSTMSK
EEEEEEEEDEEEDYALDKSEFPTEADLEDFTEA
AADEDEDEEEEEEEEGEEVVEDRDYYYDSFKG
DDYNEENPTEPSSDGTIS
DKEIAHD
VKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRN
NFESEDYCMAVCKTM
IPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLE
IRHRSRMDRVKKEWEEAELQAKNLPKAERQTLIQHFQAMVKALEKEAASE
KQQLVETHLARVEAMLNDRRRIALENYLAALQSDPPRPHRILQALRRYVR
AENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLY
KVPYVAQEIQEEIDELLQEQRADMDQFTSSISENPVDVRVSSEESEEIPP
FHPFHPFPSLSENED
TQPELYHPMKKGSGMAEQDGGLIGAEEKVINSKNK
MDENMVIDETLDVKEMIFNAERVGGLEEEPDSVGPLREDFSLSSS
ALIGL
LVIAVAIATVIVISLVML
RKRQYGTISHGIVEVHPMLTPEERHLNKMQNH
G
YENPTYKYLEQMQI
Original MAATGTAAAAATGKLLVLLLLGLTAPAAALAGYIEALAANAGTGFAVAEP
QIAMFCGKLNMHVNIQTGKWEPDPTGTKSCLGTKEEVLQYCQEIYPELQI
TNVMEANQPVNIDSWCRRDKKQCRSHIVIPFKCLVGEFVSDVLLVPENCQ
FFHQERMEVCEKHQRWHTVVKEACLTEGMTLYSYGMLLPCGVDQFHGTEY
VCCPQTKVVDSDSTMSKEEEEEEEEDEEEDYALDKSEFPTEADLEDFTEA
AADEDEDEEEEEEEEGEEVVEDRDYYYDSFKGDDYNEENPTEPSSDGTIS
DKEIAHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRN
NFESEDYCMAVCKTMIPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLE
IRHRSRMDRVKKEWEEAELQAKNLPKAERQTLIQHFQAMVKALEKEAASE
KQQLVETHLARVEAMLNDRRRIALENYLAALQSDPPRPHRILQALRRYVR
AENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLY
KVPYVAQEIQEEIDELLQEQRADMDQFTSSISENPVDVRVSSEESEEIPP
FHPFHPFPSLSENEDTQPELYHPMKKGSGMAEQDGGLIGAEEKVINSKNK
MDENMVIDETLDVKEMIFNAERVGGLEEEPDSVGPLREDFSLSSSALIGL
LVIAVAIATVIVISLVMLRKRQYGTISHGIVEVHPMLTPEERHLNKMQNH
GYENPTYKYLEQMQI
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11