Signal Peptide Database - Mammalia

 Entry Details
ID   55
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   Q00623    (Created: 1993-04-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   APOA1_MOUSE
Protein Name   Apolipoprotein A-I
Gene   Apoa1
Organism Scientific   Mus musculus
Organism Common   Mouse
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Mus
Protein Length [aa]   264
Protein Mass [Da]   30587
Features  
TypeDescriptionStatusStartEnd
signal peptide      by similarity   1   18
chain   Apolipoprotein A-I      25   264
region of interest   10 X approximate tandem repeats      67   264
repeat   1      67   88
repeat   2      89   110
repeat   3; half-length      111   121
repeat   4      122   143
repeat   5      144   165
repeat   6      166   187
repeat   7; truncated      188   207
repeat   8      208   229
repeat   9; half-length      230   240
repeat   10      241   264
propeptide      by similarity   19   24
SP Length   18
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MKAVVLAVALVFLTGSQA
Sequence MKAVVLAVALVFLTGSQAWHVWQQDEPQSQWDKVKDFANVYVDAVKDSGR
DYVSQFESSSLGQQLN
LNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEK
ETDWVRQEMN
KDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQ
ESARQKLQELQGRLS
PVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQR
LAELKSN
PTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTKA
QSVIDKASETLTAQ
Original MKAVVLAVALVFLTGSQAWHVWQQDEPQSQWDKVKDFANVYVDAVKDSGR
DYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEK
ETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQ
ESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQR
LAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTKA
QSVIDKASETLTAQ
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11