Signal Peptide Database - Mammalia

 Entry Details
ID   56
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P04114    (Created: 1986-11-01 Updated: 2009-01-20)
UniProtKB/Swiss-Prot Entry Name   APOB_HUMAN
Protein Name   Apolipoprotein B-100
Gene   APOB
Organism Scientific   Homo sapiens
Organism Common   Human
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Primates
                    Haplorrhini
                      Catarrhini
                        Hominidae
                          Homo
Protein Length [aa]   4563
Protein Mass [Da]   515563
Features  
TypeDescriptionStatusStartEnd
signal peptide         1   27
chain   Apolipoprotein B-100      28   4563
chain   Apolipoprotein B-48      28   2179
disulfide bond         39   88
disulfide bond         78   97
disulfide bond         186   212
disulfide bond         245   261
disulfide bond         385   390
disulfide bond         478   513
disulfide bond         966   976
disulfide bond         3194   3324
domain   Vitellogenin      46   672
region of interest   Heparin-binding      32   126
region of interest   Heparin-binding      232   306
region of interest   Heparin-binding      902   959
region of interest   Heparin-binding      2043   2178
region of interest   Heparin-binding      3161   3236
region of interest   Basic (possible receptor binding region)      3174   3184
region of interest   LDL receptor binding      3373   3393
region of interest   Heparin-binding      3383   3516
region of interest   Basic (possible receptor binding region)      3386   3394
modified residue   Phosphoserine      928   928
modified residue   Phosphoserine      4507   4507
glycosylation site   N-linked (GlcNAc...)   potential   34   34
glycosylation site   N-linked (GlcNAc...)   potential   185   185
glycosylation site   N-linked (GlcNAc...)   potential   983   983
glycosylation site   N-linked (GlcNAc...)   potential   1368   1368
glycosylation site   N-linked (GlcNAc...)   potential   1377   1377
glycosylation site   N-linked (GlcNAc...)      1523   1523
glycosylation site   N-linked (GlcNAc...)   potential   2239   2239
glycosylation site   N-linked (GlcNAc...)   potential   2560   2560
glycosylation site   N-linked (GlcNAc...)   potential   2779   2779
glycosylation site   N-linked (GlcNAc...)      2982   2982
glycosylation site   N-linked (GlcNAc...)   potential   3101   3101
glycosylation site   N-linked (GlcNAc...)   potential   3224   3224
glycosylation site   N-linked (GlcNAc...)   potential   3336   3336
glycosylation site   N-linked (GlcNAc...)      3358   3358
glycosylation site   N-linked (GlcNAc...)   potential   3411   3411
glycosylation site   N-linked (GlcNAc...)      3465   3465
glycosylation site   N-linked (GlcNAc...)      3895   3895
glycosylation site   N-linked (GlcNAc...)   potential   4237   4237
glycosylation site   N-linked (GlcNAc...)   potential   4431   4431
sequence variant   (in FDB; dbSNP:rs12713559)      0   0
sequence variant   (in FDB; dbSNP:rs5742904)      0   0
sequence variant   (in dbSNP:rs1042023)      0   0
sequence variant         0   0
sequence variant         0   0
sequence variant   (in dbSNP:rs12720855)      0   0
sequence variant   (in dbSNP:rs12720854)      0   0
sequence variant   (in dbSNP:rs12720848)      0   0
sequence variant   (in dbSNP:rs1801694)      0   0
sequence variant   (in dbSNP:rs2163204)      0   0
sequence variant   (in dbSNP:rs676210)      0   0
sequence variant   (in dbSNP:rs1801701)      0   0
sequence variant   (in dbSNP:rs1042025)      0   0
sequence variant   (in dbSNP:rs12713540)      0   0
sequence variant   (in dbSNP:rs12713450)      0   0
sequence variant   (in dbSNP:rs1801695)      0   0
sequence variant   (in dbSNP:rs12720843)      0   0
sequence variant   (in dbSNP:rs1042034)      0   0
sequence variant   (in dbSNP:rs1801702)      0   0
sequence variant   (in dbSNP:rs1042031)      0   0
sequence variant   (in dbSNP:rs1801703)      0   0
sequence variant   (in dbSNP:rs1126468)      0   0
sequence variant   (in dbSNP:rs1042027)      0   0
sequence variant   (in dbSNP:rs1801698)      0   0
sequence variant         0   0
sequence variant   (in dbSNP:rs1042013)      0   0
sequence variant   (in dbSNP:rs1801696)      0   0
sequence variant   (in a colorectal cancer sample; somatic mutation)      0   0
sequence variant   (in dbSNP:rs12714192)      0   0
sequence variant   (in dbSNP:rs1800476)      0   0
sequence variant   (in dbSNP:rs12691202)      0   0
sequence variant   (in dbSNP:rs679899)      0   0
sequence variant   (in dbSNP:rs12714214)      0   0
sequence variant   (in FHBL; reduced protein secretion)      0   0
sequence variant   (in dbSNP:rs12714225)      0   0
sequence variant   (in dbSNP:rs1126419)      0   0
sequence variant   (in dbSNP:rs6752026)      0   0
sequence variant   (in dbSNP:rs9282603)      0   0
sequence variant   (in dbSNP:rs1367117)      0   0
sequence variant   (in dbSNP:rs12714097)      0   0
sequence variant   (in dbSNP:rs12720801)      0   0
sequence variant   (in dbSNP:rs12713675)      0   0
sequence variant   (in dbSNP:rs1041971)      0   0
sequence variant   (in dbSNP:rs12713681)      0   0
sequence variant   (in dbSNP:rs1041960)      0   0
sequence variant   (in dbSNP:rs533617)      0   0
sequence variant   (in dbSNP:rs1801699)      0   0
sequence variant   (in dbSNP:rs1801697)      0   0
sequence variant   (in dbSNP:rs13306187)      0   0
sequence variant   (in dbSNP:rs1041956)      0   0
sequence variant   (in dbSNP:rs12713843)      0   0
sequence variant   (in dbSNP:rs12713844)      0   0
lipid moiety-binding region   S-palmitoyl cysteine      1112   1112
mutagenesis site   Impairs protein secretion      0   0
mutagenesis site   Does not affect protein secretion      0   0
mutagenesis site   Impairs protein secretion      0   0
mutagenesis site   Does not affect protein secretion      0   0
SP Length   27
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MDPPRPALLALLALPALLLLLLAGARA
Sequence MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLR
KYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLK
EVYGFNPEGKALLKKTKNSEEFAAAM
SRYELKLAIPEGKQVFLYPEKDEP
TYILNIKRGIISALLVPPETEEAKQVLFLDTVYG
NCSTHFTVKTRKGNVA
TEISTERDLGQCDRFKPIRTGISPLALIKGM
TRPLSTLISSSQSCQYTLD
AKRKHVAEAICKEQHLFLPFSYNNKYGMVAQVTQTLKLEDTPKINSRFFG
EGTKKM
GLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNK
LVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKR
VHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVN
NYHKTNPTGTQELLDIANYLMEQIQDDCTGDEDYTYLILRVIGNMGQTME
QLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLD
DASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANI
LNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDP
ASAKIEGNLIFDPNNYLPKESM
LKTTLTAFGFASADLIEIGLEGKGFEPT
LEALFGKQGFFPDSVNKALYWVNGQVPDGVSKVLVDHFGYTKDDKHEQDM
VNGIMLSVEKLIKDLKSKEVPEARAYLRILGEELGFASLHDLQLLGKLLL
MGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQISS
SGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQ
M
NTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKT
EVIPPLIEN
RQSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTR
LELELRPTGEIEQYSVSATYELQREDRALVDTLKFVTQAEGAKQTEATMT
FKYNRQSMTLSSEVQIPDFDVDLGTILRVNDESTEGKTSYRLTLDIQNKK
ITEVALMGHLS
CDTKEERKIKGVISIPRLQAEARSEILAHWSPAKLLLQM
DSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDY
PKSLHMYANRLLDHRVPETDMTFRHVGSKLIVAMSSWLQKASGSLPYTQT
LQDHLNSLKEFNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPL
PFGGKSSRDLKMLETVRTPALHFKSVGFHLPSREFQVPTFTIPKLYQLQV
PLLGVLDLSTNVYSNLY
NWSASYSGGNTSTDHFSLRARYHMKADSVVDLL
SYNVQGSGETTYDHKNTFTLSCDGSLRHKFLDSNIKFSHVEKLGNNPVSK
GLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGT
YGLSCQRDPNTGRLNGESNLRF
NSSYLQGTNQITGRYEDGTLSLTSTSDL
QSGIIKNTASLKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRS
EYQADYESLRFFSLLSGSLNSHGLELNADILGTDKINSGAHKATLRIGQD
GISTSATTNLKCSLLVLENELNAELGLSGASMKLTTNGRFREHNAKFSLD
GKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSNDMMGSYAEMK
FDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSD
LKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSAS
YKADTVAKVQGVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVM
APFTMTIDAHTNGNGKLALWGEHTGQLYSKFLLKAEPLAFTFSHDYKGST
SHHLVSRKSISAALEHKVSALLTPAEQTGTWKLKTQFNNNEYSQDLDAYN
TKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDALEM
RDAVEKPQ
EFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVVENVQRNLK
HINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYR
ITENDIQIALDDAKINFNEKLSQLQTYM
IQFDQYIKDSYDLHDLKIAIAN
IIDEIIEKLKSLDEHYHIRVNLVKTIHDLHLFIENIDF
NKSGSSTASWIQ
NVDTKYQIRIQIQEKLQQLKRHIQNIDIQHLAGKLKQHIEAIDVRVLLDQ
LGTTISFERINDVLEHVKHFVINLIGDFEVAEKINAFRAKVHELIERYEV
DQQIQVLMDKLVELTHQYKLKETIQKLSNVLQQVKIKDYFEKLVGFIDDA
VKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIREVTQRL
NGEIQALELPQKAEALKLFLEETKATVAVYLESLQDTKITLIINWLQEAL
SSASLAHMKAKFRETLEDTRDRMYQMDIQQELQRYLSLVGQVYSTLVTYI
SDWWTLAAK
NLTDFAEQYSIQDWAKRMKALVEQGFTVPEIKTILGTMPAF
EVSLQALQKATFQTPDFIVPLTDLRIPSVQINFKDLKNIKIPSRFSTPEF
TILNTFHIPSFTIDFVEMKVKIIRTIDQMQNSELQWPVPDIYLRDLKVED
IPLARITLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPEFQLPHISHTI
EVPTFGKLYSILKIQSPLFTLDANADIG
NGTTSANEAGIAASITAKGESK
LEVLNFDFQANAQLSNPKINPLALKESVKFSSKYLRTEHGSEMLFFGNAI
EGKSNTVASLHTEKNTLELSNGVIVKINNQLTLDSNTKYFHKLNIPKLDF
SSQADLRNEIKTLLKAGHIAWTSSGKGSWKWACPRFSDEGTHESQISFTI
EGPLTSFGLSNKINSKHLRVNQNLVYESGSL
NFSKLEIQSQVDSQHVGHS
VLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKNSLFFSAQPFEITAST
NNEGNLKVRFPLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQ
NFSAGNNENIMEAHVGINGEANLDFLNIPLTIPEMRLPYTIITTPPLKDF
SLWEKTGLKE
FLKTTKQSFDLSVKAQYKKNKHRHSITNPLAVLCEFISQS
IKSFDRHFEKNRNNALDFVTKSY
NETKIKFDKYKAEKSHDELPRTFQIPG
YTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILP
SLELPVLHVPRNLKLSLPHFKELC
TISHIFIPAMGNITYDFSFKSSVITL
NTNAELF
NQSDIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALS
LSNKFVEGSH
NSTVSLTTKNMEVSVAKTTKAEIPILRMNFKQELNGNTKS
KPTVSSSMEFKYDF
NSSMLYSTAKGAVDHKLSLESLTSYFSIESSTKGDV
KGSVLSREYSGTIASE
ANTYLNSKSTRSSVKLQGTSKIDDIWNLEVKENF
AGEATLQRIYSLWEHSTKNHLQLEGLFFTNGEHTSKATLELSPWQMSALV
QVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVEL
SNDQEKAHLDIAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQ
HLRVSTAFVYTKNPNGYSFSIPVKVLADKFITPGLKLNDLNSVLVMPTFH
VPFTDLQVPSCKLDFREIQIYKKLRTSSFALNLPTLPEVKFPEVDVLTKY
SQPEDSLIPFFEITVPESQLTVSQFTLPKSVSDGIAALDLNAVANKIADF
ELPTIIVPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDSPVY
NATWSA
SLKNKADYVETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGTLA
HRDFSAEYEEDGKFEGLQEWEGKAHLNIKSPAFTDLHLRYQKDKKGISTS
AASPAVGTVGMDMDEDDDFSKWNFYYSPQSSPDKKLTIFKTELRVRESDE
ETQIKVNWEEEAASGLLTSLKDNVPKATGVLYDYVNKYHWEHTGLTLREV
SSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQKAASGTTGTYQEWKDKAQN
LYQELLTQEGQASFQGLKDNVFDGLVRVTQKFHMKVKHLIDSLIDFLNFP
RFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKVH
NGSEILFSYFQDLV
ITLPFELRKHKLIDVISMYRELLKDLSKEAQEVFKAIQSLKTTEVLRNLQ
DLLQFIFQLIEDNIKQLKEMKFTYLINYIQDEINTIFNDYIPYVFKLLKE
NLCLNLHKFNEFIQNELQEASQELQQIHQYIMALREEYFDPSIVGWTVKY
YELEEKIVSLIKNLLVALKDFHSEYIVSAS
NFTSQLSSQVEQFLHRNIQE
YLSILTDPDGKGKEKIAELSATAQEIIKSQAIATKKIISDYHQQFRYKLQ
DFSDQL
SDYYEKFIAESKRLIDLSIQNYHTFLIYITELLKKLQSTTVMNP
YMKLAPGELTIIL
Original MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLR
KYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLK
EVYGFNPEGKALLKKTKNSEEFAAAMSRYELKLAIPEGKQVFLYPEKDEP
TYILNIKRGIISALLVPPETEEAKQVLFLDTVYGNCSTHFTVKTRKGNVA
TEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLISSSQSCQYTLD
AKRKHVAEAICKEQHLFLPFSYNNKYGMVAQVTQTLKLEDTPKINSRFFG
EGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNK
LVTELRGLSDEAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKR
VHANPLLIDVVTYLVALIPEPSAQQLREIFNMARDQRSRATLYALSHAVN
NYHKTNPTGTQELLDIANYLMEQIQDDCTGDEDYTYLILRVIGNMGQTME
QLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKDQEVLLQTFLD
DASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANI
LNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDP
ASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPT
LEALFGKQGFFPDSVNKALYWVNGQVPDGVSKVLVDHFGYTKDDKHEQDM
VNGIMLSVEKLIKDLKSKEVPEARAYLRILGEELGFASLHDLQLLGKLLL
MGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPTGAGLQLQISS
SGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQ
MNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKT
EVIPPLIENRQSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTR
LELELRPTGEIEQYSVSATYELQREDRALVDTLKFVTQAEGAKQTEATMT
FKYNRQSMTLSSEVQIPDFDVDLGTILRVNDESTEGKTSYRLTLDIQNKK
ITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAHWSPAKLLLQM
DSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDY
PKSLHMYANRLLDHRVPETDMTFRHVGSKLIVAMSSWLQKASGSLPYTQT
LQDHLNSLKEFNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPL
PFGGKSSRDLKMLETVRTPALHFKSVGFHLPSREFQVPTFTIPKLYQLQV
PLLGVLDLSTNVYSNLYNWSASYSGGNTSTDHFSLRARYHMKADSVVDLL
SYNVQGSGETTYDHKNTFTLSCDGSLRHKFLDSNIKFSHVEKLGNNPVSK
GLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGT
YGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDL
QSGIIKNTASLKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRS
EYQADYESLRFFSLLSGSLNSHGLELNADILGTDKINSGAHKATLRIGQD
GISTSATTNLKCSLLVLENELNAELGLSGASMKLTTNGRFREHNAKFSLD
GKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSNDMMGSYAEMK
FDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSD
LKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSAS
YKADTVAKVQGVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVM
APFTMTIDAHTNGNGKLALWGEHTGQLYSKFLLKAEPLAFTFSHDYKGST
SHHLVSRKSISAALEHKVSALLTPAEQTGTWKLKTQFNNNEYSQDLDAYN
TKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDALEMRDAVEKPQ
EFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVVENVQRNLK
HINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYR
ITENDIQIALDDAKINFNEKLSQLQTYMIQFDQYIKDSYDLHDLKIAIAN
IIDEIIEKLKSLDEHYHIRVNLVKTIHDLHLFIENIDFNKSGSSTASWIQ
NVDTKYQIRIQIQEKLQQLKRHIQNIDIQHLAGKLKQHIEAIDVRVLLDQ
LGTTISFERINDVLEHVKHFVINLIGDFEVAEKINAFRAKVHELIERYEV
DQQIQVLMDKLVELTHQYKLKETIQKLSNVLQQVKIKDYFEKLVGFIDDA
VKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIREVTQRL
NGEIQALELPQKAEALKLFLEETKATVAVYLESLQDTKITLIINWLQEAL
SSASLAHMKAKFRETLEDTRDRMYQMDIQQELQRYLSLVGQVYSTLVTYI
SDWWTLAAKNLTDFAEQYSIQDWAKRMKALVEQGFTVPEIKTILGTMPAF
EVSLQALQKATFQTPDFIVPLTDLRIPSVQINFKDLKNIKIPSRFSTPEF
TILNTFHIPSFTIDFVEMKVKIIRTIDQMQNSELQWPVPDIYLRDLKVED
IPLARITLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPEFQLPHISHTI
EVPTFGKLYSILKIQSPLFTLDANADIGNGTTSANEAGIAASITAKGESK
LEVLNFDFQANAQLSNPKINPLALKESVKFSSKYLRTEHGSEMLFFGNAI
EGKSNTVASLHTEKNTLELSNGVIVKINNQLTLDSNTKYFHKLNIPKLDF
SSQADLRNEIKTLLKAGHIAWTSSGKGSWKWACPRFSDEGTHESQISFTI
EGPLTSFGLSNKINSKHLRVNQNLVYESGSLNFSKLEIQSQVDSQHVGHS
VLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKNSLFFSAQPFEITAST
NNEGNLKVRFPLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQ
NFSAGNNENIMEAHVGINGEANLDFLNIPLTIPEMRLPYTIITTPPLKDF
SLWEKTGLKEFLKTTKQSFDLSVKAQYKKNKHRHSITNPLAVLCEFISQS
IKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEKSHDELPRTFQIPG
YTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILP
SLELPVLHVPRNLKLSLPHFKELCTISHIFIPAMGNITYDFSFKSSVITL
NTNAELFNQSDIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALS
LSNKFVEGSHNSTVSLTTKNMEVSVAKTTKAEIPILRMNFKQELNGNTKS
KPTVSSSMEFKYDFNSSMLYSTAKGAVDHKLSLESLTSYFSIESSTKGDV
KGSVLSREYSGTIASEANTYLNSKSTRSSVKLQGTSKIDDIWNLEVKENF
AGEATLQRIYSLWEHSTKNHLQLEGLFFTNGEHTSKATLELSPWQMSALV
QVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVEL
SNDQEKAHLDIAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQ
HLRVSTAFVYTKNPNGYSFSIPVKVLADKFITPGLKLNDLNSVLVMPTFH
VPFTDLQVPSCKLDFREIQIYKKLRTSSFALNLPTLPEVKFPEVDVLTKY
SQPEDSLIPFFEITVPESQLTVSQFTLPKSVSDGIAALDLNAVANKIADF
ELPTIIVPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDSPVYNATWSA
SLKNKADYVETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGTLA
HRDFSAEYEEDGKFEGLQEWEGKAHLNIKSPAFTDLHLRYQKDKKGISTS
AASPAVGTVGMDMDEDDDFSKWNFYYSPQSSPDKKLTIFKTELRVRESDE
ETQIKVNWEEEAASGLLTSLKDNVPKATGVLYDYVNKYHWEHTGLTLREV
SSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQKAASGTTGTYQEWKDKAQN
LYQELLTQEGQASFQGLKDNVFDGLVRVTQKFHMKVKHLIDSLIDFLNFP
RFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKVHNGSEILFSYFQDLV
ITLPFELRKHKLIDVISMYRELLKDLSKEAQEVFKAIQSLKTTEVLRNLQ
DLLQFIFQLIEDNIKQLKEMKFTYLINYIQDEINTIFNDYIPYVFKLLKE
NLCLNLHKFNEFIQNELQEASQELQQIHQYIMALREEYFDPSIVGWTVKY
YELEEKIVSLIKNLLVALKDFHSEYIVSASNFTSQLSSQVEQFLHRNIQE
YLSILTDPDGKGKEKIAELSATAQEIIKSQAIATKKIISDYHQQFRYKLQ
DFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLIYITELLKKLQSTTVMNP
YMKLAPGELTIIL
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11