Signal Peptide Database - Mammalia

 Entry Details
ID   57
Source Database   UniProtKB/Swiss-Prot
UniProtKB/Swiss-Prot Accession Number   P55797    (Created: 1997-11-01 Updated: 2008-12-16)
UniProtKB/Swiss-Prot Entry Name   APOC4_RAT
Protein Name   Apolipoprotein C-IV
Gene   Apoc4
Organism Scientific   Rattus norvegicus
Organism Common   Rat
Lineage   Eukaryota
  Metazoa
    Chordata
      Craniata
        Vertebrata
          Euteleostomi
            Mammalia
              Eutheria
                Euarchontoglires
                  Glires
                    Rodentia
                      Sciurognathi
                        Muroidea
                          Muridae
                            Murinae
                              Rattus
Protein Length [aa]   124
Protein Mass [Da]   14532
Features  
TypeDescriptionStatusStartEnd
signal peptide      potential   1   27
chain   Apolipoprotein C-IV      28   124
splice variant   (in isoform 2)      70   124
SP Length   27
 ----+----1----+----2----+----3----+----4----+----5
Signal Peptide MSLLRCRQQTLPSLCLSVLFLACFVAS
Sequence MSLLRCRQQTLPSLCLSVLFLACFVASMPTESLTPTPGPENSRWSLVRAR
VMEMVEPLVTRTRDRWRWF
WGPRAIQGFVQTYYEDHLKDLGPRTQAWLQS
SRDHLLNKTHSLCPRLLCRDWTQG
Original MSLLRCRQQTLPSLCLSVLFLACFVASMPTESLTPTPGPENSRWSLVRAR
VMEMVEPLVTRTRDRWRWFWGPRAIQGFVQTYYEDHLKDLGPRTQAWLQS
SRDHLLNKTHSLCPRLLCRDWTQG
 ----+----1----+----2----+----3----+----4----+----5
Hydropathies  
 

© 2007-2017 Katja Kapp, Dresden & thpr.net e. K., Dresden, Germany, last update 2010-06-11